KEGG   Pan paniscus (bonobo): 100971044
Entry
100971044         CDS       T02283                                 

Gene name
TNFRSF10A
Definition
(RefSeq) TNF receptor superfamily member 10a
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps05132  Salmonella infection
pps05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100971044 (TNFRSF10A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100971044 (TNFRSF10A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100971044 (TNFRSF10A)
   04217 Necroptosis
    100971044 (TNFRSF10A)
   04115 p53 signaling pathway
    100971044 (TNFRSF10A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100971044 (TNFRSF10A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100971044 (TNFRSF10A)
  09172 Infectious disease: viral
   05164 Influenza A
    100971044 (TNFRSF10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100971044 (TNFRSF10A)
   04090 CD molecules [BR:pps04090]
    100971044 (TNFRSF10A)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100971044 (TNFRSF10A)
CD molecules [BR:pps04090]
 Proteins
  100971044 (TNFRSF10A)
SSDB
Motif
Pfam: Death TNFR_c6 CARD_2
Other DBs
NCBI-GeneID: 100971044
NCBI-ProteinID: XP_003823628
UniProt: A0A2R9C3Q3
LinkDB
Position
8
AA seq 469 aa
MAPPPAGVNLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGREALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNQCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTSNTACQCKPGTFRNDNSAEMCRKCSTGCPRGMVKVKDCTPWSDIECVHKESGNGHNV
WVILVVTLVVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEI
LSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGAD
PTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKT
GRNASIHTLLDALERMEERHAKEKIQDLLVDSGKFIYLEDGTGSAVSLE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcgccaccaccagctggagtaaatctaggtgcgttcctggcagtgactccgaatccc
gggagcgcagcgagtgggacagaggcagccgcggccacacccagcaaagtgtggggctct
tccgcggggaggattgaaccacgaggcgggggccgagaagcgctccctacctccatggga
cagcacggacccagtgcccgggcccgggcagggcgcgccccaggacccaggccggcgcgg
gaagccagccctcggctccgggtccacaagaccttcaagtttgtcgtcgtcggggtcctg
ctgcaggtcgtacctagctcagctgcaaccatcaaacttcatgatcaatcaattggcaca
cagcaatgggaacatagccctttgggagagttgtgtccaccaggatctcatagatcagaa
catcctggagcctgtaaccagtgcacagagggtgtgggttacaccaatgcttccaacaat
ttgtttgcttgcctcccatgtacagcttgtaaatcagatgaagaagagagaagtccctgc
accacgaccagcaacacagcatgtcagtgcaaaccaggaactttccggaatgacaattct
gctgagatgtgccggaagtgcagcacagggtgccccagagggatggtcaaggtcaaggat
tgtacaccctggagtgacatcgagtgtgtccacaaagaatcaggcaatggacataatgta
tgggtgattttggttgtgactttggttgttgttccgttgctgttggtggctgtgctgatt
gtctgttgttgcatcggctcaggttgtggaggggaccccaagtgcatggacagggtgtgt
ttctggcgcttgggtctcctacgagggcctggggctgaggacaatgctcacaacgagatt
ctgagcaacgcagactcgctgtccactttcgtctctgagcagcaaatggaaagccaggag
ccggcagatttgacaggtgtcactgtacagtccccaggggaggcacagtgtctgctggga
ccggcagaagctgaagggtctcagaggaggaggctgctggttccagcaaatggtgctgac
cccactgagactctgatgctgttctttgacaagtttgcaaacatcgtgccctttgactcc
tgggaccagctcatgaggcagctggacctcacgaaaaatgagatcgatgtggtcagagct
ggtacagcaggcccaggggatgcattgtatgcaatgctgatgaaatgggtcaacaaaact
ggacggaacgcctcgatccacaccctgctggatgccttggagaggatggaagagagacat
gcaaaagagaagattcaggacctcttggtggactctggaaagttcatctacttggaagat
ggcacaggctctgccgtgtccttggagtga

KEGG   Pan paniscus (bonobo): 100973227
Entry
100973227         CDS       T02283                                 

Gene name
TNFRSF10B
Definition
(RefSeq) TNF receptor superfamily member 10b
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps05132  Salmonella infection
pps05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100973227 (TNFRSF10B)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100973227 (TNFRSF10B)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100973227 (TNFRSF10B)
   04217 Necroptosis
    100973227 (TNFRSF10B)
   04115 p53 signaling pathway
    100973227 (TNFRSF10B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100973227 (TNFRSF10B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100973227 (TNFRSF10B)
  09172 Infectious disease: viral
   05164 Influenza A
    100973227 (TNFRSF10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100973227 (TNFRSF10B)
   04090 CD molecules [BR:pps04090]
    100973227 (TNFRSF10B)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100973227 (TNFRSF10B)
CD molecules [BR:pps04090]
 Proteins
  100973227 (TNFRSF10B)
SSDB
Motif
Pfam: TNFR_c6 Death RskA
Other DBs
NCBI-GeneID: 100973227
NCBI-ProteinID: XP_003823634
UniProt: A0A2R8Z6I2
LinkDB
Position
8
AA seq 410 aa
MEQRGQNAPAASGARKRHGPGPREARGARPGLRVPKTLVLIVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDSRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVEVSPCTTTRNTACQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGIIIGVAVAAVVLIVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAED
NALNEIVSILQPTQVPEQEMEVQEPAEPTGVNMSPGESEHLPEPAEAEGSQRRRLLVPAN
EGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWV
NKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggaacaacggggacagaacgccccggccgcttcgggggcccggaaaaggcacggccca
ggacccagggaggcgcggggagccaggcctgggctccgggttcccaagacccttgtgctc
attgtcgccgcggtcctgctgttggtctcagctgagtctgctctgatcacccaacaagac
ctagctccccagcagagagcggccccacaacaaaagaggtccagcccctcagagggattg
tgtccacctggacaccatatctcagaagacagtagagattgcatctcctgcaaatatgga
caggactatagcactcactggaatgacctccttttctgcttgcgctgcaccaggtgtgat
tcaggtgaagtggaggtaagtccctgcaccacgaccagaaacacagcgtgtcagtgcgaa
gaaggcaccttccgggaagaagattctcctgagatgtgccggaagtgccgcacagggtgt
cccagagggatggtcaaggtcggtgattgtacaccctggagtgacatcgaatgtgtccac
aaagaatcaggcatcatcataggagtcgcagttgcagccgtagtcttgattgtggctgtg
tttgtttgcaagtctttactgtggaagaaagtccttccttacctgaaaggcatctgctca
ggtggtggtggggaccctgagcgtgtggacagaagctcacaacggcctggggctgaggac
aatgccctcaatgagatcgtgagtatcttgcagcccacccaggtccctgagcaggaaatg
gaagtccaggagccagcagagccaacaggtgtcaacatgtccccaggggagtcagagcat
ctgccggaaccggcagaagctgaagggtctcagaggaggaggctgctggttccagcgaat
gaaggtgatcccactgagactctgagacagtgcttcgatgactttgcagacttggtgccc
tttgactcctgggagccgctcatgaggaagttgggcctcatggacaatgagataaaggtg
gctaaagctgaggcagcgggccacagggacaccttgtacacgatgctgataaagtgggtc
aacaaaaccgggcgagatgcctctgtccacaccctgctggatgccttggagacgctggga
gagagacttgccaagcagaagattgaggaccacttgttgagctctggaaagttcatgtat
ctagaaggtaatgcagactctgccatgtcctaa

DBGET integrated database retrieval system