KEGG   Pan paniscus (bonobo): 100971732
Entry
100971732         CDS       T02283                                 

Gene name
EIF2S1
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03013  RNA transport
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04932  Non-alcoholic fatty liver disease
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05160  Hepatitis C
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100971732 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100971732 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100971732 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    100971732 (EIF2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100971732 (EIF2S1)
   05012 Parkinson disease
    100971732 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    100971732 (EIF2S1)
   05020 Prion disease
    100971732 (EIF2S1)
   05022 Pathways of neurodegeneration - multiple diseases
    100971732 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100971732 (EIF2S1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100971732 (EIF2S1)
   05164 Influenza A
    100971732 (EIF2S1)
   05162 Measles
    100971732 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    100971732 (EIF2S1)
Translation factors [BR:pps03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    100971732 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1 DUF4453
Other DBs
NCBI-GeneID: 100971732
NCBI-ProteinID: XP_003824115
UniProt: A0A2R9CGS8
LinkDB
Position
14
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtcagatccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aacattgaaggcatgattcttcttagtgaattatccagaaggcgtatccgttctatcaac
aaactcatccgaattggcaggaatgagtgtgtggttgtcattagggtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgcttgaccccacaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctaagagcaggtttgaattgttctaca
gaaaacatgcccattaagattaatctaatagctcctcctcggtatgtaatgactacgaca
accctggagagaacagaaggcctttctgtcctcagtcaagctatggctgttatcaaagag
aagattgaggaaaagaggggtgtgttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcaaggcagatggagaggcttgaaagagaaaatgccgaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system