KEGG   Pan paniscus (bonobo): 100972676
Entry
100972676         CDS       T02283                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04390  Hippo signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
pps05218  Melanoma
pps05224  Breast cancer
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100972676 (FGF1)
   04014 Ras signaling pathway
    100972676 (FGF1)
   04015 Rap1 signaling pathway
    100972676 (FGF1)
   04390 Hippo signaling pathway
    100972676 (FGF1)
   04151 PI3K-Akt signaling pathway
    100972676 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100972676 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972676 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100972676 (FGF1)
   05218 Melanoma
    100972676 (FGF1)
   05224 Breast cancer
    100972676 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100972676 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100972676 (FGF1)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100972676 (FGF1)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100972676 (FGF1)
SSDB
Motif
Pfam: FGF Fascin Methyltrans_RNA
Other DBs
NCBI-GeneID: 100972676
NCBI-ProteinID: XP_003829149
LinkDB
Position
5
AA seq 214 aa
MHHAATLSPFLQCPPDTGPESGLEGAGISHLLKCWMQPLSFGRSRKLRLESATSSSCXAM
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQL
SAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcaccatgccgccacattatctccattcctccagtgcccgcctgacactggccctgaa
tcagggctggagggggcaggcatttctcatttactaaagtgctggatgcagcccttgagt
ttcggcagaagcagaaagctgcgtcttgaaagcgccacaagcagcagctgctgagccatg
gctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctccaggg
aattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatcctt
ccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctc
agtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttggcc
atggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttcctg
gaacggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaagaat
tggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaatcttgtttctccccctgccagtctcttccgattaa

DBGET integrated database retrieval system