KEGG   Pan paniscus (bonobo): 100974112
Entry
100974112         CDS       T02283                                 

Gene name
BBC3
Definition
(RefSeq) BCL2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04390  Hippo signaling pathway
pps05016  Huntington disease
pps05162  Measles
pps05200  Pathways in cancer
pps05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100974112 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100974112 (BBC3)
   04215 Apoptosis - multiple species
    100974112 (BBC3)
   04115 p53 signaling pathway
    100974112 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974112 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100974112 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100974112 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    100974112 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100974112 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core DUF3886
Other DBs
NCBI-GeneID: 100974112
NCBI-ProteinID: XP_003817529
UniProt: A0A2R9BZA9
LinkDB
Position
19
AA seq 131 aa
MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQA
APGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLP
RGHRAPEMEPN
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaatttggcatggggtctgcccaggcatgtccatgccaggtgcccagggctgcttcc
gtgacgtgggtcccctgccagatttgtggtcctcagccctcgctctcgctggcggagcag
cacctggagtcgcccgtgcccagcgccccgggggctctggcgggcggtcccacccaggcg
gccccgggagtccgcggggaggaggaacagtgggcccgggagatcggggcccagctgcgg
cggatggcggacgacctcaacgcgcagtacgagcggcggagacaagaggagcagcagcgg
caccgcccctcgccctggagggtcctgtacaatctcatcatgggactcctgcccttaccc
aggggccacagagcccccgagatggagcccaattag

DBGET integrated database retrieval system