KEGG   Pan paniscus (bonobo): 100974364Help
Entry
100974364         CDS       T02283                                 

Gene name
RNPEP
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100974364 (RNPEP)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     100974364 (RNPEP)
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M1
   100974364 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 100974364
NCBI-ProteinID: XP_008974885
UniProt: A0A2R9BNE8
LinkDB All DBs
Position
1
AA seq 650 aa AA seqDB search
MASGQPSPGSGAAPRPLHSAQAVDVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLS
GTAVLDLRCLEPEGAAELRLDSHPCLEVTTAALRRERPGSEEPPAEPVSFYTQPFSHYGQ
ALCVSFPQSCRAAERLQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFFFQMCQPIPSYLIALAIGDLVS
AEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCF
VSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPSISNARNAELRLRWGQIVLKNNHQEDFWKVKEFLHNQGK
QKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggccagccttcccccggcagcggcgcggccccgcggccgctgcactccgcg
caggctgtggacgtggcctcggcctccaacttccgggcctttgagctgctgcacttgcac
ctggacctgcgggctgagttcgggcctccagggcccggcgcagggagccggggactgagc
ggcaccgcggtcctggacctgcgctgcctggagcccgagggcgccgccgagctgcggctg
gactcgcacccgtgcctggaggtgacgacggcggcgctgcggcgggagcggcccggctcg
gaggagccgcccgcggagcccgtgagcttctacacgcagcccttctcgcactatggccag
gccctgtgcgtgtccttcccgcagtcctgccgcgccgccgagcgcctccaggtgctgctc
acctaccgcgtcggggagggacccggggtttgctggttggctcctgagcagacagcagga
aagaagaagcccttcgtgtacacccagggccaggctgtcctaaaccgggccttcttccct
tgcttcgacacgcctgctgttaaatacaagtattcagctcttattgaggtcccagatggc
ttcacagctgtgatgagtgctagcacctgggagaagagaggtccaaataagttcttcttc
cagatgtgtcagcccatcccctcctatctgatagctttggccatcggagatctggtttcg
gctgaagttggacccaggagccgggtgtgggctgagccctgcctgattgatgctgccaag
gaggagtacaacggggtgatagaagaatttttggcaacaggagagaagctttttggacct
tatgtttggggaaggtatgacttgctcttcatgccaccgtcctttccatttggaggaatg
gagaacccttgtctgacctttgtcaccccctgcctgctagctggggaccgctccttggca
gatgtcatcatccatgagatctcccacagttggtttgggaacctggtcaccaacgccaac
tggggtgaattctggctcaatgaaggtttcaccatgtacgcccagagaaggatctccacc
atcctctttggcgctgcgtacacctgcttggaggctgcaacggggcgggctctgctgcgt
cagcacatggacatcactggagaggaaaacccactcaacaagctccgcgtgaagattgaa
ccaggcgttgacccggacgacacctataatgagaccccctacgagaaaggtttctgcttt
gtctcatacctggcccacttggtgggtgatcaggatcagtttgacagttttctcaaggcc
tatgtgcatgaattcaaattccgaagcatcttagccgatgactttctggacttctacttg
gaatatttccctgagcttaagaaaaagagagtggatatcattccaggttttgagtttgat
cgatggctgaatacccctggctggcccccgtacctccctgatctctcccctggggactca
ctcatgaagcctgctgaagagctagcccaactgtgggcagccgaggagctggacatgaag
gccattgaagccgtggccatctctccctggaagacctaccagctggtctacttcctggat
aagatcctccagaaatcccctctccctcctgggaatgtgaaaaaacttggagagacatac
ccaagtatctcaaatgcccggaatgcagagctccggctgcgatggggccaaatcgtcctt
aagaacaaccaccaggaagatttctggaaagtgaaggagttcctgcataaccaggggaag
cagaagtatacacttccgctgtaccacgcaatgatgggtggcagtgaggtggcccagacc
ctcgccaaggagacttttgcatccaccgcctcccagctccacagcaatgttgtcaactat
gtccagcagatcgtggcacccaagggcagttag

DBGET integrated database retrieval system