KEGG   Pan paniscus (bonobo): 100974406Help
Entry
100974406         CDS       T02283                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00512  Mucin type O-glycan biosynthesis
pps01100  Metabolic pathways
Module
pps_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100974406 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pps01003]
    100974406 (WBSCR17)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100974406 (WBSCR17)
Glycosyltransferases [BR:pps01003]
 O-Glycan biosynthesis
  Mucin-type
   100974406 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100974406
NCBI-ProteinID: XP_008961929
LinkDB All DBs
Position
7
AA seq 505 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYIXPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQVGARL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtagctggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcttgaagcgcctgtcgctgctggaggacatcgtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggccttccg
gctactctttccccggctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcctatctcagtgaaaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaatgaggccctgtcggtgatcctgcggtccgtgcacagtgccgtcaatcacacaccc
acacacctgctgaaggaaatcattctggtggatgacaacagcgacgaagaggagctgaag
gtccccctggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggccaccgggcag
gtcactggcttctttgatgcccacgtggaattcaccgctggctgggctgagccggttcta
tcccgcatccaggaaaaccggaggcgtgtgatcctcccctccattgacaacatcaaacag
gacaactttgaggtgcagcggtacgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcnagcccccaaaagactggtgggacgccggagacccttctctccccatc
aggaccccagccatgataggctgctcgttcgtggtcaacaggaagttcttcggtgaaatt
ggtcttctggatcctggcatggatgtatacggaggagaaaatattgaactgggaatcaag
gtatggctctgtgggggcagcatggaggtccttccttgctcacgggtggcccacattgag
cggaagaagaagccatataatagcaacattggcttctacaccaagaggaatgctcttcgt
gttgctgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaacctgccg
ctggagaatccgggaattgacatcggtgatgtctccgaaagaagagcattaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgagaagatac
aataataccgttgcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatattgtatccgtgccatggctggggaccacag
gtaggagctcgtctctga

DBGET integrated database retrieval system