Pan paniscus (bonobo): 100975544 Help Entry 100975544         CDS       T02283                                  Name (RefSeq) C-X-C motif chemokine 3   KO K05505   C-X-C motif chemokine 1/2/3 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway pps04621   NOD-like receptor signaling pathway pps04657   IL-17 signaling pathway pps04668   TNF signaling pathway pps04936   Alcoholic liver disease pps05134   Legionellosis pps05146   Amoebiasis pps05167   Kaposi sarcoma-associated herpesvirus infection pps05323   Rheumatoid arthritis pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100975544    04668 TNF signaling pathway     100975544   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100975544    04061 Viral protein interaction with cytokine and cytokine receptor     100975544  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100975544    04657 IL-17 signaling pathway     100975544    04062 Chemokine signaling pathway     100975544  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100975544   09171 Infectious disease: bacterial    05134 Legionellosis     100975544   09174 Infectious disease: parasitic    05146 Amoebiasis     100975544   09163 Immune disease    05323 Rheumatoid arthritis     100975544   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100975544   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100975544  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100975544 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100975544 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Lenti_VIF_2 Motif Other DBs NCBI-GeneID:  100975544 NCBI-ProteinID:  XP_034814562 Ensembl:  ENSPPAG00000038628 LinkDB All DBs Position 4:50152730..50154974 Genome browser AA seq 107 aa AA seqDB search MARATLSTAPSNPRLLRVALLLLLLVAAGRRAAGASVVTELRCQCLQTLQGIHLKNIQSV NVKSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccacgctctccaccgcccccagcaatccccggctcctgcgggtggcgctg ctgctcctgctcctggtggccgccggccggcgcgcagcaggagcgtccgtggtcactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg aatgtgaagtccccaggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggaagaaagcttgtctcaacccggcatcccccatggttcagaaaatcatcgaaaagata ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system