KEGG   Pan paniscus (bonobo): 100976265
Entry
100976265         CDS       T02283                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100976265 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100976265 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 100976265
NCBI-ProteinID: XP_003821026
LinkDB
Position
1
AA seq 355 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVANLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHAKPEQKQMVAQQESIREGFQKGCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIISRYYQHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDNTGKMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKHREIKRTNSSQLV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaacttgatgattcaaaatgctggggcggtgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagcaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgctaagcctgaacagaaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaaaggctgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtggctacagaaaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaataattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagtgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccactg
aacattatcagaaaagctggtgaaaccccgaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaacgta
ttatttgacctaagtgacaacactgggaaaatggaagtactggtggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggttattaaggccaaa
aaaaaacatagagaaataaaaaggaccaattcaagccaactggtctaa

DBGET integrated database retrieval system