KEGG   Pan paniscus (bonobo): 100976546
Entry
100976546         CDS       T02283                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00220  Arginine biosynthesis
pps00330  Arginine and proline metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04146  Peroxisome
pps04371  Apelin signaling pathway
pps04926  Relaxin signaling pathway
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05133  Pertussis
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05200  Pathways in cancer
pps05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100976546 (NOS2)
   00330 Arginine and proline metabolism
    100976546 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100976546 (NOS2)
   04066 HIF-1 signaling pathway
    100976546 (NOS2)
   04020 Calcium signaling pathway
    100976546 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100976546 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100976546 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100976546 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100976546 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100976546 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100976546 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100976546 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100976546 (NOS2)
   05152 Tuberculosis
    100976546 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100976546 (NOS2)
   05145 Toxoplasmosis
    100976546 (NOS2)
   05140 Leishmaniasis
    100976546 (NOS2)
   05142 Chagas disease
    100976546 (NOS2)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100976546 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 100976546
NCBI-ProteinID: XP_008963431
LinkDB
Position
17
AA seq 1152 aa
MREGLGAACEAAGPRLCRLLCRILRPKPDCCPRRASPVTQDDLQYHNLSKQQNESPQPLV
ETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMT
PKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGR
FDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTI
LFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGN
GEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDE
LSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLS
KALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQP
ALVQGILERVVDGPTPHQTVHLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQL
LLQKLAQVATEATERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLP
ILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCFV
RNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDE
DHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYV
CGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRV
AVQPSNLEMSAL
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggcgcggcgtgcgaggccgccgggccccggctgtgtaggctgctc
tgcaggatcctccggccgaagcctgactgctgcccgcgcagagccagtccagtgacacag
gatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctcgtg
gagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcctcc
ccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacacttcac
cataaagccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatgact
cccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttctacct
caagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaactg
acgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgcatt
gggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccactgcccgg
gaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtggaat
gctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggaccct
gccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggccgc
ttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaaatc
ccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgggaa
ctggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggcggc
ctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtccgg
gacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggcttg
gaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacattgct
gtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgcagaa
tccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagactgg
atttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatgctg
aactatgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtctgg
caggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaagct
gtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcaccatc
ctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttgttc
agctgtgccttcaaccccaaggttgtctgcatggataagtacaggctgagctgcctggag
gaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggcaat
ggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcaggtac
gctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgacatt
gatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggatgag
ctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcctgt
gagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctccaat
gtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctcagc
aaagccctcagcagcatgcatgccaagaacgtgttcaccatgaggctcaaatctcggcag
aatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgaggat
ggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccagccg
gccctggtccaaggcatcctggagcgagtggtggatggccccacaccccaccagacagtg
cacctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgcccccc
tgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccagctg
ctgctccaaaagctggcccaggtggccacagaagcgactgagagacagaggctggaggcc
ctttgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctggag
gtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctcccc
attctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggagatc
cacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcaccac
ggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgctttgtg
cggaatgccagcggcttccacctccccgaggatccctcccatccttgcatcctcatcggg
cctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcccag
cacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagatgag
gaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcggtg
cacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctgcgg
cagcagctggccagcgaggtgctccgtgtgctccacaaggagccaggccacctctatgtt
tgcggggatgtgcgcatggcccgggacgtggcccataccctgaagcagctggtggctgcc
aagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccagaag
cgctatcacgaagatatctttggtgctgtatttccctacgaggcgaagaaggacagggtg
gcggtgcagcccagcaacctggagatgtcagcgctctga

DBGET integrated database retrieval system