KEGG   Pan paniscus (bonobo): 100977351Help
Entry
100977351         CDS       T02283                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03410  Base excision repair
Module
pps_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100977351 (LIG3)
Enzymes [BR:pps01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100977351 (LIG3)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100977351 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme HD_2 Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 100977351
NCBI-ProteinID: XP_008969526
LinkDB All DBs
Position
17
AA seq 1018 aa AA seqDB search
MSKFRGLRYMSLAFKILFPQTLRALSRKELCLFRKRHWRDVRQFSQWSETDLLHGHPLFL
RRKPILSFQGSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEK
IVKGVCRIGKLVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKXEDLTELEGWEELED
NEKEQITQHIADLSSKAAGTPKKKAVVQAKLTATGQVTSPVKGASFVTSTNPRKFSGFSA
KPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLR
KGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVS
ETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKC
IIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRAL
SVQASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLK
PVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVC
LFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQ
EGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIF
LMGCYDPGSQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKVNKIYYPDF
IVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQL
SKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKD
GNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPD
FSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttccgaggcctacgctatatgtctttggctttcaagatcctctttccacaa
accctccgtgcactcagccgaaaagaactgtgcctattccgaaaacgtcactggcgtgat
gtaagacaattcagccagtggtcagaaacagatctgcttcatggacatcccctcttcctg
agaagaaagcctattctatcattccagggaagccatctaagatcacgtgccacctacctt
gttttcttgccagggttgcatgtgggactctgcagtggcccctgtgagatggctgagcaa
cggttctgtgtggactatgccaagcgtggcacagctggctgcaaaaaatgcaaggaaaag
attgtgaagggcgtatgccgaattggcaaactggtgcccaatcccttctcagagtctggg
ggtgatatgaaagagtggtaccacattaaatgcatgtttgagaaactagagcgggcccgg
gccaccacaaaaaaantcgaggacctcacagagctggaaggctgggaagagctggaagat
aatgagaaggaacagataacccagcacattgcagatctgtcttctaaggcagcaggtaca
ccaaagaagaaagctgttgtccaggctaagttgacagccactggccaggtgacttctcca
gtgaaaggcgcctcatttgtcaccagtaccaatccccggaaattttctggcttttcagcc
aagcccaacaactctggggaagccccctcgagccccacccctaagagaagtctgtcttca
agcaaatgtgaccccaggcataaggactgtctgctacgggagtttcgaaagttatgcgcc
atggtggctgataatcctagctacaacacgaagacccagatcatccaggacttccttcgg
aaaggctcagcaggagatggtttccacggtgatgtgtacctaacagtgaagctgctgctg
ccaggagtcattaagactgtttacaacttgaatgataagcagattgtgaagcttttcagt
cgcatttttaactgcaacccagatgatatggcacgggacctagagcagggtgacgtgtca
gagacaatcagagtcttctttgagcagagcaagtctttccccccagctgccaagagcctc
cttaccatccaggaagtggatgagttccttctgcggctgtccaagctcaccaaggaggat
gagcagcaacaggccctacaggacattgcctccaggtgtacagccaatgaccttaaatgc
atcatcaggttgatcaaacatgatctgaagatgaactcaggtgcaaaacatgtgttagac
gcccttgaccccaatgcctatgaagccttcaaagcctcgcgcaacctgcaggatgtggtg
gagcgggtccttcacaacgcgcaggaggtggagaaggagccgggccagagacgggctctg
agcgtccaggcctcgctgatgacacctgtgcagcccatgttggcggaggcctgcaagtcc
gttgagtatgcaatgaagaaatgtcccaatggcatgttctctgagatcaagtacgatgga
gagcgagtccaggtgcataagaatggagaccacttcagctacttcagccgcagtctcaag
cccgtccttcctcacaaggtggcccactttaaggactacattccccaggcttttcctggg
ggccacagcatgatcttggattctgaagtgcttctgattgacaacaagacaggcaaacca
ctgccctttgggactctgggagtgcacaagaaagcagccttccaggatgctaatgtctgc
ctgtttgtttttgattgtatctactttaatgatgtcagcttgatggacagacctctgtgt
gagcggcggaagtttcttcatgacaacatggttgaaattccaaaccggatcatgttctca
gaaatgaagcgagtcacaaaagctttggacttggctgacatgataacccgggtgatccag
gagggattggaggggctggtgctgaaggatgtgaagggtacatatgagcctgggaagcgg
cactggctgaaagtgaagaaagactatttgaacgagggggccatggccgacacagctgac
ctggtggtccttggagccttctatgggcaagggagcaaaggcggcatgatgtcaatcttc
ctcatgggctgctacgaccctggcagccagaagtggtgcacagtcaccaagtgtgcagga
ggccatgatgatgccacgcttgcccgcctgcagaaggaactagacatggtgaagatcagc
aaggaccccagcaaaatacccagctggttgaaggtcaacaagatctactatcctgacttc
atcgtcccagacccaaagaaagctgccgtgtgggagatcacaggggctgaattctccaaa
tcggaggctcatacagctgacgggatctccatccgattccctcgctgcacccgaatccga
gatgataaggactggaaatctgccactaaccttccccaactcaaggaactgtaccagttg
tccaaggagaaggcagacttcactgtagtggctggagatgaggggagctccactacaggg
ggtagcagtgaagagaataagggtccctcagggtctgctgtgtcccgcaaggcccccagc
aagccctcagccagtaccaagaaagcagaagggaagctgagtaactccaacagcaaagat
ggcaacatgcagactgcaaagccttccgctatgaaggtgggggagaagctggccacaaag
tcttctccagtgaaagtaggggagaagcggaaagctgctgatgagacgctgtgccaaaca
aaggtattgctggacatcttcactggggtgcggctttacttgccaccctccacaccagac
ttcagccgtctcagacgctactttgtggcattcgacggggacctggtacaggaatttgat
atgacttcagccacgcacgtgctgggtagcagggacaagaaccctgcggctcagcaggtc
tccccagagtggatttgggcatgtatccggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system