KEGG   Pan paniscus (bonobo): 100977916
Entry
100977916         CDS       T02283                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04218  Cellular senescence
pps04630  JAK-STAT signaling pathway
pps04921  Oxytocin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100977916 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100977916 (CDKN1A)
   04066 HIF-1 signaling pathway
    100977916 (CDKN1A)
   04068 FoxO signaling pathway
    100977916 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100977916 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100977916 (CDKN1A)
   04115 p53 signaling pathway
    100977916 (CDKN1A)
   04218 Cellular senescence
    100977916 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100977916 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100977916 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100977916 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100977916 (CDKN1A)
   05206 MicroRNAs in cancer
    100977916 (CDKN1A)
   05205 Proteoglycans in cancer
    100977916 (CDKN1A)
   05203 Viral carcinogenesis
    100977916 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100977916 (CDKN1A)
   05212 Pancreatic cancer
    100977916 (CDKN1A)
   05225 Hepatocellular carcinoma
    100977916 (CDKN1A)
   05226 Gastric cancer
    100977916 (CDKN1A)
   05214 Glioma
    100977916 (CDKN1A)
   05216 Thyroid cancer
    100977916 (CDKN1A)
   05220 Chronic myeloid leukemia
    100977916 (CDKN1A)
   05217 Basal cell carcinoma
    100977916 (CDKN1A)
   05218 Melanoma
    100977916 (CDKN1A)
   05211 Renal cell carcinoma
    100977916 (CDKN1A)
   05219 Bladder cancer
    100977916 (CDKN1A)
   05215 Prostate cancer
    100977916 (CDKN1A)
   05213 Endometrial cancer
    100977916 (CDKN1A)
   05224 Breast cancer
    100977916 (CDKN1A)
   05222 Small cell lung cancer
    100977916 (CDKN1A)
   05223 Non-small cell lung cancer
    100977916 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100977916 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100977916 (CDKN1A)
   05161 Hepatitis B
    100977916 (CDKN1A)
   05160 Hepatitis C
    100977916 (CDKN1A)
   05163 Human cytomegalovirus infection
    100977916 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100977916 (CDKN1A)
   05169 Epstein-Barr virus infection
    100977916 (CDKN1A)
   05165 Human papillomavirus infection
    100977916 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100977916 (CDKN1A)
   01522 Endocrine resistance
    100977916 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100977916
NCBI-ProteinID: XP_008970560
UniProt: A0A2R9BI00
LinkDB
Position
6
AA seq 164 aa
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system