KEGG   Pan paniscus (bonobo): 100980497Help
Entry
100980497         CDS       T02283                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04110  Cell cycle
pps04213  Longevity regulating pathway - multiple species
pps04330  Notch signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05016  Huntington's disease
pps05034  Alcoholism
pps05165  Human papillomavirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100980497 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100980497 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100980497 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    100980497 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100980497 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100980497 (HDAC1)
   05203 Viral carcinogenesis
    100980497 (HDAC1)
   05220 Chronic myeloid leukemia
    100980497 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100980497 (HDAC1)
  Substance dependence
   05034 Alcoholism
    100980497 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100980497 (HDAC1)
   05165 Human papillomavirus infection
    100980497 (HDAC1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100980497 (HDAC1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100980497 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100980497 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100980497 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100980497 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100980497
NCBI-ProteinID: XP_003828201
LinkDB All DBs
Position
1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcactcggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggt
gacggcgtggaagaggccttctataccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacccggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagaagac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagttacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system