KEGG   Pan paniscus (bonobo): 100980973
Entry
100980973         CDS       T02283                                 

Gene name
MSN
Definition
(RefSeq) moesin
  KO
K05763  moesin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04530  Tight junction
pps04670  Leukocyte transendothelial migration
pps04810  Regulation of actin cytoskeleton
pps05162  Measles
pps05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100980973 (MSN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100980973 (MSN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100980973 (MSN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100980973 (MSN)
  09172 Infectious disease: viral
   05162 Measles
    100980973 (MSN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100980973 (MSN)
   04147 Exosome [BR:pps04147]
    100980973 (MSN)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     100980973 (MSN)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100980973 (MSN)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 100980973
NCBI-ProteinID: XP_003816963
UniProt: A0A2R9AZU4
LinkDB
Position
X
AA seq 577 aa
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcccaaaacgatcagtgtgcgtgtgaccaccatggatgcagagctggagtttgccatc
cagcccaacaccaccgggaagcagctatttgaccaggtggtgaaaactattggcttgagg
gaagtttggttctttggtctgcagtaccaggacactaaaggtttctccacctggctgaaa
ctcaataagaaggtgactgcccaggacgtgcggaaggaaagccccctgctctttaagttc
cgtgccaagttctaccctgaggatgtgtccgaggaattgattcaggacatcactcagcgc
ctgttctttctgcaagtgaaagagggcattctcaatgatgatatttactgcccgcctgag
accgctgtgctgctggcctcgtatgctgtccagtctaagtatggtgacttcaataaggaa
gtgcataagtctggctacctggccggagacaagttgctcccgcagagagtcctggaacag
cacaaactcaacaaggaccagtgggaggagcggatccaggtgtggcatgaggaacaccgt
ggcatgctcagggaggatgctgtcctggaatatctgaagattgctcaagatctggagatg
tatggtgtgaactacttcagcatcaagaacaagaaaggctcagagctgtggctgggggtg
gatgccctgggtctcaacatctatgagcagaatgatagactaactcccaagataggcttc
ccctggagtgaaatcaggaacatctctttcaatgataagaaatttgtcatcaagcccatt
gacaaaaaagccccggacttcgtcttctatgctccccggctgcggattaacaagcggatc
ttggccttgtgcatggggaaccatgaactatacatgcgccgtcgcaagcctgacaccatt
gaggtgcagcagatgaaggcacaggcccgggaggagaagcaccagaagcagatggagcgt
gctatgctggaaaatgagaagaagaagcgtgaaatggcagaaaaggagaaagagaagatt
gaacgggagaaggaggagctgatggagaggctgaagcagatcgaggaacagactaagaag
gctcagcaagaactggaagaacagacccgtagggctctggaacttgagcaggaacggaag
cgtgcccagagcgaggctgaaaagctggccaaggagcgtcaagaagctgaagaggccaag
gaggccttgctgcaggcctcccgggaccagaaaaagactcaggaacagctggccttggaa
atggcagagctgacagctcgaatctcccagctggagatggcccgacagaagaaggagagt
gaggctgtggagtggcagcagaaggcccagatggtacaggaagacttggagaagacccgt
gctgagctgaagactgccatgagtacacctcatgtggcagagcctgctgagaatgagcag
gatgagcaggatgagaatggggcagaggctagtgctgacctacgggctgatgctatggcc
aaggaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
cacctgaaggccctcacttcggagctggccaatgccagagatgagtccaagaagactgcc
aatgacatgatccatgctgagaacatgcgactgggccgagacaaatacaagaccctgcgc
cagatccggcagggcaacaccaagcagcgcattgacgaatttgagtctatgtaa

DBGET integrated database retrieval system