KEGG   Pan paniscus (bonobo): 100981368Help
Entry
100981368         CDS       T02283                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04614  Renin-angiotensin system
pps04924  Renin secretion
pps05142  Chagas disease (American trypanosomiasis)
pps05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100981368
   04614 Renin-angiotensin system
    100981368
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100981368
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100981368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pps01002]
    100981368
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100981368
   04090 CD Molecules [BR:pps04090]
    100981368
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100981368
Peptidases [BR:pps01002]
 Metallo Peptidases
  Family M2
   100981368
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100981368
CD molecules [BR:pps04090]
 Proteins
  100981368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 SmpA_OmlA
Motif
Other DBs
NCBI-GeneID: 100981368
NCBI-ProteinID: XP_008962042
LinkDB All DBs
Position
17
AA seq 751 aa AA seqDB search
MELASPSSAALLVMGARWTCPGPSLLVLLCYGQLFPWLRIKGEHSLDDFYNETEAKIFLQ
FYDQTGEVVLNKFMEATWNYVTNITRKNQEEMLHKDMERSQFMIYFGTQARLFKVTQFKD
PDVNGMLSKLQNIDKAALSKDELREYNELLAYMEMTYSMAQVCLNEGPCLSLEPELEVMA
TSRDKEELLWAWQGWQDAVGCQICTTFEHYVELSNKASQLNGYKDMGALWRSKYESDTLE
QDLERLFQELRPLYLNLHTYVRRALHRHYGPELIDLRGPIPAHLLENTLAQSWVNILDPV
LPFLKKIPEDVTKIMKVQHWKPEKMLEEAETFFTSLALPPAPPSFWKKLMLMRPTDGREV
ECHISAWNFYQDDDFRIKKCTEVTTEDPLSIFHEMGHSXYFLQYKNLSVIFRAGANPAFE
EAVGSVITLSASSHKHLLNIGLLSLXHQDSEDEVNFLMHIALEKIAFIPFGYLMDLFRWK
VFAGTIWKDIYNQEWWNLRLKYQGLCPAIPHSEEDFDPGAKFHISAGVPYIRYFLSLVLR
FQFHETLCKASDHMGPLHQCDIYNSKIAGKLLGDALKLGSSKPWPEVLKMLTGESEVSTK
VFMTYFKPLLTWLVTXNMQQGDILGWPDFSCSFEEKDTDKVTFLSLKLDPNQAKFGYWVL
LALGFVMSLVVLGLACRLQSLEKQSLTQDTEIFSPLPNACFLGIAMEPCQAAKGQWMLLG
LCLVLMLCSISLAIWIFTQXSRKPPRVRAEW
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcctcacccagctctgctgctctcttggtcatgggagcaaggtggacttgc
cctggaccttccctacttgtgctcctctgttatgggcagctctttccttggctcaggatc
aagggtgaacacagtttagatgacttctacaatgagaccgaggccaagatcttcctgcag
ttttatgaccaaacaggtgaagttgtgttgaacaagttcatggaggccacttggaactat
gtcaccaacatcaccagaaaaaatcaggaggagatgctgcacaaggacatggagaggtcc
cagttcatgatttactttggcacccaggcccgcctgtttaaagtcacccagttcaaggac
ccggatgtgaatggcatgctgagtaagctgcagaacatagacaaggcagctctgtccaag
gacgagctgcgggagtataacgagcttctggcctacatggagatgacatacagtatggcc
caggtgtgcctgaatgaggggccctgcctgtccctggagcctgaactcgaagtcatggcc
acctccagggacaaagaggagctgctgtgggcctggcagggctggcaggatgccgtgggc
tgccagatctgcaccaccttcgagcactatgtggagctcagcaacaaggcttcacagctc
aacggttacaaagacatgggggccttgtggcgctccaagtatgagtcggataccctggag
caagacctggagcggctattccaggagctgcggccactctacctgaacctgcacacctac
gtgcgcagggccctccaccgccactatgggcccgagctcatcgacctgagggggcccatc
cctgcccacctcctggagaacacgttggctcagtcctgggtcaacatcttagacccggtc
ctgcccttcctgaagaagatcccagaggatgtcacaaagatcatgaaagtccagcactgg
aagccagagaaaatgttggaagaggctgagacattcttcacctccttggcgctgccacct
gccccacccagtttctggaaaaagttgatgctaatgaggccaaccgatgggcgagaggtg
gagtgtcacatctctgcctggaacttctaccaggacgacgatttcagaataaagaagtgc
acggaagtgaccacagaagacccgctctccatcttccacgaaatgggccattctnagtac
ttcctgcagtacaagaacctctccgtcatcttccgcgcaggtgccaacccagcctttgaa
gaggctgtggggtctgtgatcaccctctcggcctcctcccacaagcacctgctcaacata
ggcctgctcagcctctagcaccaggactcagaggatgaggtcaatttcctgatgcatatt
gccctggagaagatcgccttcatccccttcggctacctgatggacctgtttcgctggaag
gtctttgccggcaccatctggaaggacatctacaatcaggagtggtggaacctcaggttg
aaataccagggcttgtgccccgctattcctcactcagaggaagactttgatccaggtgcc
aagttccacatttctgctggtgtgccctacatacggtacttcctcagtctggtgctccgg
ttccagttccacgaaacactgtgcaaagcctcggaccacatgggtccactgcaccagtgt
gacatctacaactccaagattgccgggaagctcctgggggatgctctaaagctgggctca
agcaagccctggccagaggtcctaaagatgctgactggggagtctgaggtgtctacaaag
gtcttcatgacctacttcaaacccctactgacctggctggtgacanngaacatgcagcaa
ggggacatcttaggctggccagacttcagctgttcctttgaagaaaaagacacagacaaa
gtgacattcctgagtctgaagctggaccccaaccaggctaaatttgggtactgggtgctg
ttggccctgggctttgtcatgtctctggtggtgctggggctggcctgcaggctgcagtcc
ctggaaaaacagtcactgactcaagacactgagatattcagcccactgcccaatgcctgc
ttcctgggcatagccatggaaccctgccaggctgctaaaggacagtggatgctgctgggc
ctctgccttgtcctgatgctgtgctcaatcagcctggccatctggattttcacacagtaa
agcaggaagcctccaagggtaagagctgaatggtga

DBGET integrated database retrieval system