KEGG   Pan paniscus (bonobo): 100981559
Entry
100981559         CDS       T02283                                 

Gene name
IFIH1
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04622  RIG-I-like receptor signaling pathway
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100981559 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100981559 (IFIH1)
   05171 Coronavirus disease - COVID-19
    100981559 (IFIH1)
   05164 Influenza A
    100981559 (IFIH1)
   05162 Measles
    100981559 (IFIH1)
   05168 Herpes simplex virus 1 infection
    100981559 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100981559 (IFIH1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100981559 (IFIH1)
Pattern recognition receptors [BR:pps04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100981559 (IFIH1)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_22 DUF3638 AAA_19
Other DBs
NCBI-GeneID: 100981559
NCBI-ProteinID: XP_003820983
UniProt: A0A2R9BSQ5
LinkDB
Position
2B
AA seq 1025 aa
MSNGCSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNL
LQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSA
FLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARA
SPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVI
VLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLMQKLKNNRLKKENKPVIP
LPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFA
IADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVC
AEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDE
DDLKKPLKLDETDRFLMTLFFENNEMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNP
SLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCL
FSDED
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgtcgaatgggtgttccacagacgagaatttccgctatctcatctcgtgcttcagggcc
agggtgaaaatgtacatccaggtggagcctgtgctggactacctgacctttctgcctgca
gaggtgaaggagcagattcagaggacagtcgccacctccgggaacatgcaggcagttgaa
ctgctgctgagcaccttggagaagggagtctggcaccttggttggactcgggaattcgtg
gaggccctccggagaaccggcagccctctggccgcccgctacatgaaccctgagctcacg
gacttgccctctccatcgtttgagaacgctcatgatgaatatctccaactgctgaacctc
cttcagcccactctggtggacaagcttctagttagagacgtcttggataagtgcatggag
gaggaactgttgacaattgaagacagaaaccggattgctgctgcagaaaacaatggaaat
gagtcaggtgtaagagagctactaaaaaggattgtgcagaaagaaaactggttctctgca
tttctgaatgttcttcgtcaaacaggaaacaatgaacttgtccaagagttaacaggctct
gattgctcagaaagcaatgcagagattgagaatttatcacaagttgatggtcctcaagtg
gaagagcaacttctttcaaccacagttcagccaaatctggagaaggaggtctggggcatg
gagaataactcatcagaatcatcttttgcagattcttctgtagtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaatgtggcagcaagagca
tccccggagccagaactccagctcaggccttaccaaatggaagttgcccagccagccttg
gaagggaagaatatcatcatctgcctccctacagggagtggaaaaaccagagtggctgtt
tacattgccaaggatcacttagacaagaagaaaaaagcatctgagcctggaaaagttata
gttcttgtcaataaggtactgctagttgaacagctcttccgcaaggagttccaaccattt
ttgaagaaatggtatcgtgttattggattaagtggtgatacccaactgaaaatatcattt
ccagaagttgtcaagtcctgtgatattattatcagtacagctcaaatccttgaaaactcc
ctcttaaacttggaaaatggagaagatgctggtgttcaattgtcagacttttccctcatt
atcattgatgaatgtcatcacaccaacaaagaagcagtgtataataacatcatgaggcgt
tatttgatgcagaagttgaaaaacaatagactcaagaaagaaaacaaaccagtgattccc
cttcctcagatactgggactaacagcttcacctggtgttggaggggccacgaagcaagcc
aaagctgaagaacacattttaaaactatgtgccaatcttgatgcatttactattaaaact
gttaaagaaaaccttgatcaactgaaaaaccaaatacaggagccatgcaagaagtttgcc
attgcagatgcaaccagagaagatccatttaaagagaaacttctagaaataatgacaagg
attcaaacttattgtcaaatgagtccaatgtcagattttggaactcaaccctatgaacaa
tgggccattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagaacgtgtttgt
gcagaacatttgaggaagtacaatgaggccctacaaattaatgacactattcgaatgata
gatgcgtatactcatcttgaaactttctataatgaagagaaagataagaagtttgcagtc
atagaagatgatagtgatgagggtggtgatgatgagtattgtgatggtgatgaagatgag
gatgatttaaagaaacctttgaaactggatgaaacagatagatttctcatgactttattt
tttgaaaacaatgaaatgttgaaaaggctggctgaaaacccagaatatgaaaatgaaaag
ctgaccaaattaagaaataccataatggagcaatatactaggactgaggaatcagcacga
ggaataatctttacaaaaacacgacagagtgcatatgcgctttcccagtggattactgaa
aatgaaaaatttgctgaagtaggagtcaaagcccaccatctgattggagctggacacagc
agtgagttcaaacccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcact
ggaaaaataaatctgcttatcgctaccacagtggcagaagaaggtctggatattaaagaa
tgtaacattgttatccgttatggtctcgtcaccaatgaaatagccatggtccaggcccgt
ggtcgagccagagctgatgagagcacctacgtcctcgttgctcacagcggttcaggagtt
atcgaacgtgagacagttaatgatttccgagagaagatgatgtataaagctatacattgt
gttcaaaatatgaaaccagaggagtatgctcataagattttggaattacagatgcaaagt
ataatggaaaagaaaatgaaaaccaagagaaatattgccaagcattacaagaataaccca
tcactaataactttcctttgcaaaaactgcagtgtgctagcctgttctggggaagatatc
cacgtaattgagaaaatgcatcacgtcaatatgaccccagaattcaaggaactttacatt
gtaagagaaaacaaagcactgcaaaagaagtgtgccgactatcaaataaatggtgaaatc
atctgcaaatgtggccaggcttggggaacaatgatggtgcacaaaggcttagatttgcct
tgtctcaaaataaggaattttgtagtggttttcaaaaataattcaacaaagaaacaatac
aaaaagtgggtagaattacctatcacatttcccaatcttgactattcagaatgctgttta
tttagtgatgaggattag

DBGET integrated database retrieval system