KEGG   Pan paniscus (bonobo): 100982798Help
Entry
100982798         CDS       T02283                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100982798 (F13A1)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100982798 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100982798
NCBI-ProteinID: XP_003806770
LinkDB All DBs
Position
6
AA seq 732 aa AA seqDB search
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRLEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVVKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET
LRNVWIHLDGPGITRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacttccaggactgcctttggaggcagaagagcagttccacccaataactct
aatgcagcggaagatgacctgcccacagtggagcttcagggcgtggtgccccggggcgtc
aacctgcaagagtttcttaatgtcacgagcgttcacctgttcaaggagagatgggacact
aacaaggtggaccaccacaccgacaagtatgaaaacaacaagctgattgtccgcagaggg
cagtctttctatgtgcagattgacttcagtcgtccatatgaccccagaagggatctcttc
aggctggaatacgtcattggtcgctacccacaggagaacaagggaacgtacatcccagtg
cctatagtctcagagttacaaagtggaaagtggggggccaagattgtcatgagagaggac
aggtctgtgcggctgtccatccagtcttcccccaaatgtattgtggggaaattccgcatg
tatgttgctgtctggactccctatggcgtacttcgaaccagtcgaaacccagaaacagac
acatacattctcttcaatccttggtgtgaagatgatgctgtgtatctggacaatgagaaa
gaaagagaagagtatgtcctgaatgacatcggggtaattttttatggagaggtcaatgac
atcaagaccagaagctggagctatggtcagtttgaagatggcatcctggacacttgcctg
tatgtgatggacagagcacaaatggacctctctggaagagggaatcccatcaaagtcagc
cgtgtggggtctgcaatggtgaatgccaaagatgacgaaggtgtcctcgttggatcctgg
gacaatatctatgcctatggcgtccccccatcggcctggactggaagcgttgacattcta
ttggaataccggagctctgagaatccagtccggtatggccaatgctgggtttttgctggt
gtctttaacacatttttacgatgccttggaataccagcaagaattgttaccaattatttc
tctgcccatgataatgatgccaatttgcaaatggacatctttctggaagaagatggaaac
gtgaattccaaacttaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacaaggcctgaccttcctgttggatttggaggctggcaagctgtggacagcaccccc
caggaaaatagcgatggcatgtatcggtgtggccccgcctcggttcaagccatcaagcac
ggccacgtctgcttccaatttgatgcaccttttgtttttgcagaggtcaacagcgacctc
atttacattacagctaagaaagatggcactcatgtggtggaaaatgtggatgccacccac
attgggaaattaattgtgaccaaacaaattggaggagatggcatgatggatattactgat
acttacaaattccaagaaggtcaagaagaagagagattggccctagaaactgccctgatg
tatggagctaaaaagcccctcaacacagaaggtgtcgtgaaatcaaggtccaacgttgac
atggactttgaagtggaaaatgctgtgctgggaaaagacttcaagctctccatcaccttc
cggaacaacagccacaaccgttacaccatcacagcttatctctcagccaacatcaccttc
tacaccggggtcccgaaggcagaattcaagaaggagacgttcgacgtgacgctggagccc
ttgtccttcaagaaagaggcggtgctgatccaagccggtgagtacatgggtcagctgctg
gaacaagcgtccctgcacttctttgtcacagctcgcatcaatgagaccagggatgttctg
gccaagcaaaagtccaccgtgctaaccatccctgagatcatcatcaaggtccgtggcact
caggtagttggttctgacatgactgtgacagttgagtttaccaatcctttaaaagaaacc
ctgcgaaatgtctggatacacctggatggtcctggaataacaagaccaatgaagaagatg
ttccgtgaaatccggcccaactccaccgtgcagtgggaagaagtgtgccggccctgggtc
tctgggcatcggaagctgatagccagcatgagcagtgactccctgagacatgtgtatggc
gagctggacgtgcagattcaaagacgaccttccatgtga

DBGET integrated database retrieval system