Pan paniscus (bonobo): 100983246 Help Entry 100983246         CDS       T02283                                  Gene name BAK1 Definition (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism pps  Pan paniscus (bonobo) Pathway pps01524   Platinum drug resistance pps04141   Protein processing in endoplasmic reticulum pps04210   Apoptosis pps04215   Apoptosis - multiple species pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05160   Hepatitis C pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05202   Transcriptional misregulation in cancer pps05203   Viral carcinogenesis pps05206   MicroRNAs in cancer pps05210   Colorectal cancer pps05212   Pancreatic cancer pps05213   Endometrial cancer pps05214   Glioma pps05216   Thyroid cancer pps05217   Basal cell carcinoma pps05218   Melanoma pps05220   Chronic myeloid leukemia pps05222   Small cell lung cancer pps05223   Non-small cell lung cancer pps05224   Breast cancer pps05225   Hepatocellular carcinoma pps05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100983246 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100983246 (BAK1)    04215 Apoptosis - multiple species     100983246 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100983246 (BAK1)    05202 Transcriptional misregulation in cancer     100983246 (BAK1)    05206 MicroRNAs in cancer     100983246 (BAK1)    05203 Viral carcinogenesis     100983246 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     100983246 (BAK1)    05212 Pancreatic cancer     100983246 (BAK1)    05225 Hepatocellular carcinoma     100983246 (BAK1)    05226 Gastric cancer     100983246 (BAK1)    05214 Glioma     100983246 (BAK1)    05216 Thyroid cancer     100983246 (BAK1)    05220 Chronic myeloid leukemia     100983246 (BAK1)    05217 Basal cell carcinoma     100983246 (BAK1)    05218 Melanoma     100983246 (BAK1)    05213 Endometrial cancer     100983246 (BAK1)    05224 Breast cancer     100983246 (BAK1)    05222 Small cell lung cancer     100983246 (BAK1)    05223 Non-small cell lung cancer     100983246 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     100983246 (BAK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100983246 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100983246 (BAK1)    05160 Hepatitis C     100983246 (BAK1)    05164 Influenza A     100983246 (BAK1)    05162 Measles     100983246 (BAK1)    05168 Herpes simplex virus 1 infection     100983246 (BAK1)    05163 Human cytomegalovirus infection     100983246 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     100983246 (BAK1)    05169 Epstein-Barr virus infection     100983246 (BAK1)    05165 Human papillomavirus infection     100983246 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100983246 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pps03029]     100983246 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pps02000]     100983246 (BAK1) Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     100983246 (BAK1) Transporters [BR:pps02000]  Other transporters   Pores ion channels [TC:1]    100983246 (BAK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100983246 NCBI-ProteinID:  XP_003808607 UniProt:  A0A2R9A7S4 LinkDB All DBs Position 6 AA seq 211 aa AA seqDB search MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta cacgtctaccagcatggcctgactggcttcctgggccaggtgacccgcttcgtggtcgac ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc ctgaacttgggcaatggtcccatcctgaacgtgctggtagttctgggtgtggttctgttg ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system