KEGG   Pan paniscus (bonobo): 100983246
Entry
100983246         CDS       T02283                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05160  Hepatitis C
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100983246 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100983246 (BAK1)
   04215 Apoptosis - multiple species
    100983246 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100983246 (BAK1)
   05202 Transcriptional misregulation in cancer
    100983246 (BAK1)
   05206 MicroRNAs in cancer
    100983246 (BAK1)
   05203 Viral carcinogenesis
    100983246 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100983246 (BAK1)
   05212 Pancreatic cancer
    100983246 (BAK1)
   05225 Hepatocellular carcinoma
    100983246 (BAK1)
   05226 Gastric cancer
    100983246 (BAK1)
   05214 Glioma
    100983246 (BAK1)
   05216 Thyroid cancer
    100983246 (BAK1)
   05220 Chronic myeloid leukemia
    100983246 (BAK1)
   05217 Basal cell carcinoma
    100983246 (BAK1)
   05218 Melanoma
    100983246 (BAK1)
   05213 Endometrial cancer
    100983246 (BAK1)
   05224 Breast cancer
    100983246 (BAK1)
   05222 Small cell lung cancer
    100983246 (BAK1)
   05223 Non-small cell lung cancer
    100983246 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100983246 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100983246 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100983246 (BAK1)
   05160 Hepatitis C
    100983246 (BAK1)
   05164 Influenza A
    100983246 (BAK1)
   05162 Measles
    100983246 (BAK1)
   05168 Herpes simplex virus 1 infection
    100983246 (BAK1)
   05163 Human cytomegalovirus infection
    100983246 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100983246 (BAK1)
   05169 Epstein-Barr virus infection
    100983246 (BAK1)
   05165 Human papillomavirus infection
    100983246 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100983246 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100983246 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100983246 (BAK1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100983246 (BAK1)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100983246 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100983246
NCBI-ProteinID: XP_003808607
UniProt: A0A2R9A7S4
LinkDB
Position
6
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctgggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtagttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system