KEGG   Pan paniscus (bonobo): 100984780
Entry
100984780         CDS       T02283                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04151  PI3K-Akt signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05135  Yersinia infection
pps05142  Chagas disease
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100984780 (IL2)
   04151 PI3K-Akt signaling pathway
    100984780 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100984780 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100984780 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100984780 (IL2)
   04660 T cell receptor signaling pathway
    100984780 (IL2)
   04658 Th1 and Th2 cell differentiation
    100984780 (IL2)
   04659 Th17 cell differentiation
    100984780 (IL2)
   04672 Intestinal immune network for IgA production
    100984780 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984780 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100984780 (IL2)
   05321 Inflammatory bowel disease
    100984780 (IL2)
   05330 Allograft rejection
    100984780 (IL2)
   05332 Graft-versus-host disease
    100984780 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100984780 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100984780 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984780 (IL2)
   05162 Measles
    100984780 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100984780 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100984780 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100984780 (IL2)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100984780 (IL2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Cytokines
   100984780 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 100984780
NCBI-ProteinID: XP_003816453
UniProt: A0A2R9ACE1
LinkDB
Position
4
AA seq 153 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system