KEGG   Pan paniscus (bonobo): 100984845Help
Entry
100984845         CDS       T02283                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00030  Pentose phosphate pathway
pps00051  Fructose and mannose metabolism
pps00052  Galactose metabolism
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps01230  Biosynthesis of amino acids
pps03018  RNA degradation
pps04152  AMPK signaling pathway
pps05230  Central carbon metabolism in cancer
Module
pps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100984845 (PFKM)
   00030 Pentose phosphate pathway
    100984845 (PFKM)
   00051 Fructose and mannose metabolism
    100984845 (PFKM)
   00052 Galactose metabolism
    100984845 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100984845 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100984845 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100984845 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100984845 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pps03019]
    100984845 (PFKM)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100984845 (PFKM)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100984845 (PFKM)
Messenger RNA biogenesis [BR:pps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100984845 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 100984845
NCBI-ProteinID: XP_003825834
LinkDB All DBs
Position
12
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccattgctgtc
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatcttcaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagatcacatcaaggaagccacctgggagagcgtttcgatgatgcttcagctggga
ggcacggtgattggaagtgcccggtgcaaggactttcgggaacgagaaggacgactccga
gctgcctacaacctggtgaagcgtgggatcaccaatctctgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccag
aaagcaggtaagatcacagatgaggaggctacgaagtccagctacctgaacattgtgggc
ctggttgggtcaattgacaatgacttctgtggcaccgatatgaccattggcactgactct
gccctgcaccggatcatggaaattgtagatgccatcactaccactgcccagagccaccag
aggacatttgtgttagaagtaatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgaatgtccaccagatgacgactgggag
gaacacctttgtcgccgactcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcaattgacaagaatggaaaaccaatcacctcagaagacatcaag
aatctggtggttaagcgtctgggatatgacacccgggttactgtcttggggcatgtgcag
aggggtgggacgccatcagcctttgacagaattctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagataccccagcctgtgtagtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggaatgtgtccaggtgaccaaagatgtgaccaag
gccatggatgagaagaaatttgacgaagccctgaagctgagaggccggagcttcatgaac
aactgggaggtgtacaagcttctagctcatgtcagacccccggtatctaagagtggttcg
cacacagtggctgtgatgaacgtgggggctccggctgcaggcatgaatgctgctgttcgc
tccactgtgaggattggccttatccagggcaaccgagtgctcgttgtccatgatggtttc
gagggcctggccaaggggcagatagaggaagctggctggagctatgttgggggctggact
ggccaaggtggctctaaacttgggactaaaaggactctacccaagaagagctttgaacag
atcagtgccaatataactaagtttaacattcagggccttgtcatcattgggggctttgag
gcttacacagggggcctggaactgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcctgctacagtctccaacaatgtccctggctcagacttcagcgtt
ggggctgacacagcactcaatactatctgcacaacctgtgaccgcatcaagcagtcagca
gctggcaccaagcgtcgggtgtttatcattgagactatgggtggctactgtggctacctg
gctaccatggctggactggcagctggggccgatgctgcctacatttttgaggagcccttc
accattcgagacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgaaaagtgcaatgagaactataccactgacttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggt
cacatgcagcagggtgggagcccaaccccatttgataggaattttgccactaagatgggc
gccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaatactccagattcgggctgtgttctggggatgcgtaagagggctctggtcttc
caaccagtggctgagctgaaggaccagacagattttgagcatcgaatccccaaggaacag
tggtggctgaaactgaggcccatcctcaaaatcctagccaagtacgagattgacttggac
acttcagaccatgcccacctggagcacatcacccggaagcggtccggggaagctgccgtc
taa

DBGET integrated database retrieval system