KEGG   Pan paniscus (bonobo): 100985362
Entry
100985362         CDS       T02283                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04151  PI3K-Akt signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps05162  Measles
pps05165  Human papillomavirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05206  MicroRNAs in cancer
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100985362 (CDKN1B)
   04066 HIF-1 signaling pathway
    100985362 (CDKN1B)
   04068 FoxO signaling pathway
    100985362 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100985362 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100985362 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100985362 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100985362 (CDKN1B)
   05206 MicroRNAs in cancer
    100985362 (CDKN1B)
   05203 Viral carcinogenesis
    100985362 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100985362 (CDKN1B)
   05220 Chronic myeloid leukemia
    100985362 (CDKN1B)
   05215 Prostate cancer
    100985362 (CDKN1B)
   05222 Small cell lung cancer
    100985362 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100985362 (CDKN1B)
   04934 Cushing syndrome
    100985362 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100985362 (CDKN1B)
   05169 Epstein-Barr virus infection
    100985362 (CDKN1B)
   05165 Human papillomavirus infection
    100985362 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100985362 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 100985362
NCBI-ProteinID: XP_003808898
UniProt: A0A2R9A797
LinkDB
Position
12
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system