KEGG   Pan paniscus (bonobo): 100985650Help
Entry
100985650         CDS       T02283                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00590  Arachidonic acid metabolism
pps01100  Metabolic pathways
pps04064  NF-kappa B signaling pathway
pps04370  VEGF signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04668  TNF signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04726  Serotonergic synapse
pps04913  Ovarian steroidogenesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps05140  Leishmaniasis
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05204  Chemical carcinogenesis
pps05206  MicroRNAs in cancer
pps05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100985650 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100985650 (PTGS2)
   04064 NF-kappa B signaling pathway
    100985650 (PTGS2)
   04668 TNF signaling pathway
    100985650 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100985650 (PTGS2)
   04657 IL-17 signaling pathway
    100985650 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100985650 (PTGS2)
   04913 Ovarian steroidogenesis
    100985650 (PTGS2)
   04921 Oxytocin signaling pathway
    100985650 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100985650 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100985650 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100985650 (PTGS2)
   05206 MicroRNAs in cancer
    100985650 (PTGS2)
   05204 Chemical carcinogenesis
    100985650 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100985650 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100985650 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100985650 (PTGS2)
   05165 Human papillomavirus infection
    100985650 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100985650 (PTGS2)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100985650 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100985650
NCBI-ProteinID: XP_003815640
UniProt: A0A2R9CG18
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEFFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattacttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggagttctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtatcaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system