KEGG   Pan paniscus (bonobo): 100985952
Entry
100985952         CDS       T02283                                 

Gene name
CASP7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04668  TNF signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100985952 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100985952 (CASP7)
   04215 Apoptosis - multiple species
    100985952 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100985952 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100985952 (CASP7)
   05022 Pathways of neurodegeneration - multiple diseases
    100985952 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100985952 (CASP7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100985952 (CASP7)
   05133 Pertussis
    100985952 (CASP7)
   05134 Legionellosis
    100985952 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100985952 (CASP7)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     100985952 (CASP7)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100985952 (CASP7)
SSDB
Motif
Pfam: Peptidase_C14 EZH2_N
Other DBs
NCBI-GeneID: 100985952
NCBI-ProteinID: XP_003825646
LinkDB
Position
10
AA seq 303 aa
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPRFHEKKQIPCVVSMLTKELY
FSQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaag
aaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaa
gtgacaggtatgggtgttcgaaacggaacagacaaagatgccgaggcactcttcaagtgc
ttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaa
gatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccatggagaagaaaatgtaatttacgggaaagatggtgtcacaccaataaag
gatttgacagcccattttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggaccgagctcgatgatggcatccaggccgactcgggg
cccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcatggaaaagacctggaaatcatgcag
atcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgaccca
cgcttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctac
ttcagtcaatag

DBGET integrated database retrieval system