KEGG   Pan paniscus (bonobo): 100986951Help
Entry
100986951         CDS       T02283                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100986951 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100986951 (SETDB2)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100986951 (SETDB2)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100986951 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100986951 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD MBD_C
Motif
Other DBs
NCBI-GeneID: 100986951
NCBI-ProteinID: XP_003809866
LinkDB All DBs
Position
13
AA seq 719 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNAQSSDHMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQKEV
VSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTMETKYDNI
SRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGR
STACQRQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLSV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatgcccaaagc
agtgatcatatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaataaggaa
attctctctcttgaagataaagttgtagactttagagaaaaagactcatcttcaaattta
tcttatcaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaag
ggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgcaaagaca
aactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagtctacga
aacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagat
aacttttctttcaatacctatgttcagttgactcggaattacccaaagcaaaaagaagtt
gtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaa
attgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcgagcatat
aatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcata
gacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcccccttg
tcaagtgacaaaataaccactggatataaatataaaagactacagagacagattcctact
ggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaaccgagtt
gtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaagggatggggt
gtacgctgtctagatgacattgacagagggacatttgtttgcatttattcaggaagatta
ctaagcagagctaacactgaaaaatcttatggtattgatgaaaatgggagagatgagaat
actatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagattgtgaa
gttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgt
ccaccaaagttcagtaataatcccaaggagcttactatggaaacgaaatatgataatatt
tcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatttttcaa
cacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgat
ggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactca
agttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtgatagat
ataactaaatatagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattg
gataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagagggacga
tctacagcatgtcaaagacagcaggtcttttgtgatgaagagttgctaagtgaaaccaag
aatacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattggatgcc
acaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctctcggta
cagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttcactaac
aggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctgggactgtg
cctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system