KEGG   Pan paniscus (bonobo): 100986991
Entry
100986991         CDS       T02283                                 

Gene name
TNFSF10
Definition
(RefSeq) tumor necrosis factor superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04068  FoxO signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps05132  Salmonella infection
pps05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100986991 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100986991 (TNFSF10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100986991 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100986991 (TNFSF10)
   04217 Necroptosis
    100986991 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100986991 (TNFSF10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100986991 (TNFSF10)
  09172 Infectious disease: viral
   05164 Influenza A
    100986991 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100986991 (TNFSF10)
   04052 Cytokines and growth factors [BR:pps04052]
    100986991 (TNFSF10)
   04090 CD molecules [BR:pps04090]
    100986991 (TNFSF10)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100986991 (TNFSF10)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100986991 (TNFSF10)
CD molecules [BR:pps04090]
 Proteins
  100986991 (TNFSF10)
SSDB
Motif
Pfam: TNF C1q
Other DBs
NCBI-GeneID: 100986991
NCBI-ProteinID: XP_008955558
UniProt: A0A2R9C2U3
LinkDB
Position
3
AA seq 281 aa
MAMMEVQGGPSLGQTCVLIVVFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKE
DDSYWDPNDEDSMNSPCWQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQ
RVAAHITGTRGRSNTLSSPNSKNEKALGHKINSWESSRSGHSFLSNLHLRNGELVIHEKG
FYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLY
SIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
NT seq 846 nt   +upstreamnt  +downstreamnt
atggctatgatggaggtccaggggggacccagcctgggacagacctgcgtgctgatcgtg
gtcttcacagtgctcctgcagtctctctgtgtggctgtaacttacgtgtactttaccaac
gagctgaagcagatgcaggacaagtactccaaaagtggcattgcttgtttcttaaaagaa
gatgacagttattgggaccccaatgacgaagacagtatgaacagcccctgctggcaagtc
aagtggcaactccgtcagctcgttagaaagatgattttgagaacctctgaggaaaccatt
tctacagttcaagaaaagcaacaaaatatttctcccctagtgagagaaagaggtcctcag
agagtagcagctcacataactggaaccagaggaagaagcaacacattgtcttctccaaac
tccaagaatgaaaaggctctgggccacaaaataaactcctgggaatcatcaaggagtggg
cattcattcctgagcaacttgcacttgaggaatggcgaactggtcatccatgaaaaaggg
ttttactacatctattcccaaacatactttcgatttcaggaggaaataaaagaaaacaca
aagaacgacaaacaaatggtccaatatatttacaaatacacaagttatcctgaccctata
ttgttgatgaaaagcgctagaaatagttgttggtctaaagatgcagaatatggactctat
tccatctatcaagggggaatatttgagcttaaggaaaatgacagaatttttgtttctgta
acaaatgagcacttgatagacatggaccatgaagccagttttttcggggcctttttagtt
ggctaa

DBGET integrated database retrieval system