KEGG   Pan paniscus (bonobo): 100987473Help
Entry
100987473         CDS       T02283                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00020  Citrate cycle (TCA cycle)
pps00190  Oxidative phosphorylation
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps04714  Thermogenesis
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
Module
pps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pps_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100987473 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100987473 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100987473 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100987473 (SDHA)
   05012 Parkinson disease
    100987473 (SDHA)
   05016 Huntington disease
    100987473 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100987473 (SDHA)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100987473 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 100987473
NCBI-ProteinID: XP_008962714
LinkDB All DBs
Position
5
AA seq 555 aa AA seqDB search
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAF
GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIRE
GRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEE
SCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQ
EGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKVGLLTTPTCTCLFLPPGGTQPHPCIFSAFSFVAPKVNPKNAFFPPGNFDPWVLAI
FWITVTFSLLWVCIH
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaactggaggtggcatttctacgacaccgtgaagggctccgactggctg
ggggaccaggatgccatccactacatgacggagcaggcccccgccgccgtggtcgagcta
gaaaattatggcatgccgtttagcagaactgaagatgggaagatttatcagcgtgcattt
ggtggacagagcctcaagtttggaaagggcgggcaggcccatcggtgctgctgtgtggct
gatcggactggccactcgctattgcacaccttatatggaaggtctctgcgatatgatacc
agctattttgtggagtattttgccttggatctcctgatggagaacggggagtgccgtggt
gtcatcgcactgtgcatagaggacgggtccatccatcgcataagagcaaagaacactgtt
gttgccacaggaggctacgggcgcacctacttcagctgcacgtctgcccacaccagcact
ggcgacggcacggccatgatcaccagggcaggccttccttgccaggacctcgagtttgtt
cagttccaccccacaggcatatatggtgctggttgtctcattacggaaggatgtcgtgga
gagggaggcattctcattaacagtcaaggcgaaaggtttatggagcgatacgcccctgtc
gcgaaggacctggcgtctagagatgtggtgtctcggtcgatgactctggagattcgagaa
ggaagaggctgtggccctgagaaagatcacgtctacctgcagctgcaccacctacctcca
gagcagctggccacgcgcctgcctggcatttcagagacagccatgatcttcgctggcgtg
gacgtcacgaaggagccgatccctgtcctccccaccgtgcattataacatgggcggcatt
cccaccaactacaaggggcaggtcctgaggcacgtgaatggccaggatcagattgtgcct
ggcctgtacgcctgtggggaggccgcctgtgcctcggtacatggtgccaaccgccttggg
gcaaactcgctcttggacctggttgtctttggtcgggcatgtgccctgagcatcgaagag
tcatgcaggcctggagataaagtccctccaattaaaccaaacgctggggaagaatctgtc
atgaatcttgacaaattgagatttgctgatggaagcataagaacatcggaactgcgactc
agcatgcagaagtcaatgcaaaatcatgctgccgtgttccgtgtgggaagcgtgttgcaa
gaaggttgtgggaaaatcagcaagctctatggagacctaaagcacctgaagacgttcgac
cggggaatggtctggaacacggacctggtggagaccctggagctgcagaacctgatgctg
tgtgcgctgcagaccatctacggagcagaggcgcggaaggagtcacggggcgcgcatgcc
agggaagactacaaggtgggccttctcaccacacccacctgcacctgccttttcctgcca
cctggtgggactcagccccacccctgcattttctctgcattttctttcgttgccccaaaa
gtaaatccaaaaaatgcctttttcccccctggtaactttgatccctgggttctcgccatc
ttctggatcactgtgaccttttccttgctttgggtctgcatccactga

DBGET integrated database retrieval system