KEGG   Pan paniscus (bonobo): 100987761Help
Entry
100987761         CDS       T02283                                 

Gene name
STYK1
Definition
(RefSeq) serine/threonine/tyrosine kinase 1
  KO
K17510  tyrosine-protein kinase STYK1 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100987761 (STYK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100987761 (STYK1)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  Other
   100987761 (STYK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like Saf_2TM
Motif
Other DBs
NCBI-GeneID: 100987761
NCBI-ProteinID: XP_003829661
UniProt: A0A2R9B3W6
LinkDB All DBs
Position
12
AA seq 422 aa AA seqDB search
MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSG
PQGIAPVPPPRNLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQI
CSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQL
EGCCTEKLPLYMVLEDVAHGDLLSFLWTCRRDVMTMDGLLYDLTEKQVYHIGEQVLLALE
FLQDKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAISSTQTIPLKWLAPERLLL
RPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMK
SCWRWREADRPSPRELRLRLEAAIKAADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS
ML
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgacacggatgctcctggaatgcagtctcagtgacaagttgtgtgtcatccag
gagaagcagtatgaagtgattatcgtcccaactttgttggttactatcttcctcatcctt
cttggggtcatcctgtggctttttatcagagaacaaagaactcaacagcagcgttctgga
cctcaaggcattgcccctgttcctccacctaggaacctaagctgggaagcagggcatgga
ggaaatgtggctttgccacttaaggagacatccgtggaaaactttctgggagctaccaca
cctgccctggctaagctgcaggtgccgcgggagcaactctctgaagttctggagcagatt
tgcagtggtagctgtgggcccatctttcgagccaatatgaacactggggacccttctaag
cccaagagtgttattctcaaggctttaaaagaaccagctgggctccatgaggtacaagat
ttcttagggcgaatccaattccatcaatacctggggaaacacaagaacctggtgcagctg
gaaggctgctgcactgaaaagctgccactctatatggtgttggaggatgtggcccacggg
gacctgctcagctttctctggacctgtcggcgggatgtgatgactatggatggtcttctc
tatgatctcacagaaaaacaagtatatcacatcggagagcaggtccttttggcgctggaa
ttcctgcaggataagcatttgttccatggggatgtggcagccaggaatatcctgatgcaa
agtgatctcactgctaagctctgtggattaggcctggcttatgaagtttacacccgaggg
gccatctcctctactcaaaccatacctctcaagtggcttgccccagaacggcttctcctg
agacctgctagcatcagagcagatgtctggtcttttgggatcctgctctatgagatggtg
actctaggagcaccaccgtatcctgaagtccctcctaccagcatcctagagcatctccaa
agaaggaaaatcatgaagagacccagtagctgcacacataccatgtacagtattatgaag
tcctgctggcgctggcgtgaggctgaccgcccctcacctagagagctgcgcttgcgccta
gaagctgccattaaagctgcagatgacgaggctgtgttacaagtaccagagttggtggta
cctgaactgtatgcagctgtggccggcatcagagtggagagcctcttctacaactatagc
atgctttga

DBGET integrated database retrieval system