KEGG   Pan paniscus (bonobo): 100988053Help
Entry
100988053         CDS       T02283                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05034  Alcoholism
pps05165  Human papillomavirus infection
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100988053 (HDAC8)
  09165 Substance dependence
   05034 Alcoholism
    100988053 (HDAC8)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    100988053 (HDAC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100988053 (HDAC8)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100988053 (HDAC8)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100988053 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DNase-RNase
Motif
Other DBs
NCBI-GeneID: 100988053
NCBI-ProteinID: XP_003805302
LinkDB All DBs
Position
X
AA seq 415 aa AA seqDB search
MLTREHRCGRSEEQELEPWPSPKKARSRRWLRNGFKRKMEEPEEPADSGQSLVPVYIYSP
EYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgatcagaggagcaggaactagaaccctggccg
agtccgaaaaaagccagatctagaaggtggctgcggaacggttttaagcggaagatggag
gagccggaggaaccggcggacagtgggcagtcgctggtcccggtttatatctatagtccc
gagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatggtgcat
tctttgattgaagcatatgcactgcataagcaaatgaggatagttaagcctaaagtggcc
tccatggaggagatggccaccttccacactgatgcttatctgcagcatctccagaaggtc
agccaagaaggcgatgatgatcatccggactccatagaatatgggctaggttatgactgc
ccagccactgaagggatatttgactatgcagcagctataggaggggctaccatcacagct
gcccaatgcctgattgacggaatgtgcaaagtagcaattaactggtctggagggtggcat
catgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctgggaata
ttacgattgcgacggaaatttgagcgtattctctacgtggatttggatctgcaccatgga
gatggtgtagaagacgcattcagtttcacctccaaagtcatgaccgtgtccctgcacaaa
ttctccccaggatttttcccaggaacaggtgacgtgtctgatgttggcctagggaaggga
cggtactacagtgtaaatgtgcccattcaggatggcatacaagatgaaaaatattaccag
atctgtgaaagtgtactaaaggaagtataccaagcctttaatcccaaagcagtggtctta
cagctgggagctgacacaatagctggggatcccatgtgctcctttaacatgactccagtg
ggaattggcaagtgtcttaagtacatccttcaatggcagttggcaacactcattttggga
ggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggggtcatc
ctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatatggtcct
gattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccaccgaatc
caacaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system