KEGG   Pan paniscus (bonobo): 100988429
Entry
100988429         CDS       T02283                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01523  Antifolate resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04071  Sphingolipid signaling pathway
pps04137  Mitophagy - animal
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04218  Cellular senescence
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05030  Cocaine addiction
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05212  Pancreatic cancer
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100988429 (RELA)
   04014 Ras signaling pathway
    100988429 (RELA)
   04064 NF-kappa B signaling pathway
    100988429 (RELA)
   04668 TNF signaling pathway
    100988429 (RELA)
   04066 HIF-1 signaling pathway
    100988429 (RELA)
   04071 Sphingolipid signaling pathway
    100988429 (RELA)
   04024 cAMP signaling pathway
    100988429 (RELA)
   04151 PI3K-Akt signaling pathway
    100988429 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100988429 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100988429 (RELA)
   04218 Cellular senescence
    100988429 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100988429 (RELA)
   04621 NOD-like receptor signaling pathway
    100988429 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100988429 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100988429 (RELA)
   04625 C-type lectin receptor signaling pathway
    100988429 (RELA)
   04660 T cell receptor signaling pathway
    100988429 (RELA)
   04658 Th1 and Th2 cell differentiation
    100988429 (RELA)
   04659 Th17 cell differentiation
    100988429 (RELA)
   04657 IL-17 signaling pathway
    100988429 (RELA)
   04662 B cell receptor signaling pathway
    100988429 (RELA)
   04062 Chemokine signaling pathway
    100988429 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100988429 (RELA)
   04917 Prolactin signaling pathway
    100988429 (RELA)
   04926 Relaxin signaling pathway
    100988429 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100988429 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100988429 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100988429 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988429 (RELA)
   05202 Transcriptional misregulation in cancer
    100988429 (RELA)
   05203 Viral carcinogenesis
    100988429 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100988429 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100988429 (RELA)
   05221 Acute myeloid leukemia
    100988429 (RELA)
   05220 Chronic myeloid leukemia
    100988429 (RELA)
   05215 Prostate cancer
    100988429 (RELA)
   05222 Small cell lung cancer
    100988429 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100988429 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100988429 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100988429 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100988429 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100988429 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100988429 (RELA)
   04931 Insulin resistance
    100988429 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100988429 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100988429 (RELA)
   05135 Yersinia infection
    100988429 (RELA)
   05133 Pertussis
    100988429 (RELA)
   05134 Legionellosis
    100988429 (RELA)
   05152 Tuberculosis
    100988429 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100988429 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100988429 (RELA)
   05162 Measles
    100988429 (RELA)
   05164 Influenza A
    100988429 (RELA)
   05161 Hepatitis B
    100988429 (RELA)
   05160 Hepatitis C
    100988429 (RELA)
   05168 Herpes simplex virus 1 infection
    100988429 (RELA)
   05163 Human cytomegalovirus infection
    100988429 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100988429 (RELA)
   05169 Epstein-Barr virus infection
    100988429 (RELA)
   05165 Human papillomavirus infection
    100988429 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100988429 (RELA)
   05145 Toxoplasmosis
    100988429 (RELA)
   05140 Leishmaniasis
    100988429 (RELA)
   05142 Chagas disease
    100988429 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100988429 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100988429 (RELA)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100988429 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100988429
NCBI-ProteinID: XP_008952318
LinkDB
Position
11
AA seq 520 aa
MRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELV
GKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGD
YDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDE
IFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQ
LRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRI
AVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAP
APAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLG
ALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPP
DPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcgcttccgctacaagtgcgaggggcgctccgcgggcagcatcccaggcgagaggagc
acagataccaccaagacccaccccaccatcaagatcaatggctacacaggaccagggaca
gtgcgcatctccctggtcaccaaggaccctcctcaccggcctcacccccacgagcttgta
ggaaaggactgccgggatggcttctatgaggctgagctctgcccggaccgctgcatccac
agtttccagaacctgggaatccagtgtgtgaagaagcgggacctggagcaggctatcagt
cagcgcatccagaccaacaacaaccccttccaagttcctatagaagagcagcgtggggac
tacgacctgaatgctgtgcggctctgcttccaggtgacagtgcgggacccatcaggcagg
cccctccgcctgccgcctgtcctttctcatcccatctttgacaatcgtgcccccaacact
gccgagctcaagatctgccgagtgaaccgaaactctggcagctgcctcggtggggatgag
atcttcctactgtgtgacaaggtgcagaaagaggacattgaggtgtatttcacgggacca
ggctgggaggcccgaggctccttttcgcaagctgacgtgcaccgacaagtggccattgtg
ttccggacccctccctacgcagaccccagcctgcaggctcctgtgcgtgtctccatgcag
ctgcggcggccttccgaccgggagctcagtgagcccatggaattccagtacctgccagat
acagacgatcgtcaccggattgaggagaaacgtaaaaggacatatgagaccttcaagagc
atcatgaagaagagtcctttcagcggacccaccgacccccggcctccacctcgacgcatt
gctgtgccttcccgcagctcagcttctgtccccaagccagcaccccagccctatcccttt
acgtcatccctgagcaccatcaactatgatgagtttcccaccatggtgtttccttccggg
cagatcagccaggcctcggcattggccccggcccctccccaagtcctgccccaggctcca
gcccctgcccctgctccagccatggtatcagctctggcccaggccccagcccctgtccca
gtcctagccccaggccctcctcaggctgtggccccacctgcccccaagcccacccaggct
ggggaaggaacgctgtcagaggccctgctgcagctgcagtttgatgatgaagacctgggg
gccttgcttggcaacagcacagacccagctgtgttcacagacctggcatccgtcgacaac
tccgagtttcagcagctgctgaaccagggcatacctgtggccccccacacaactgagccc
atgctgatggagtaccctgaggctataactcgcctagtgacaggggcccagaggcccccc
gacccagctcctgctccactgggggccccggggctccccaatggcctcctttcaggagat
gaagacttctcctccattgcggacatggacttctcagccctgctgagtcagatcagctcc
taa

DBGET integrated database retrieval system