Pan paniscus (bonobo): 100988526 Help Entry 100988526         CDS       T02283                                  Gene name FAS Definition (RefSeq) Fas cell surface death receptor   KO K04390   tumor necrosis factor receptor superfamily member 6 Organism pps  Pan paniscus (bonobo) Pathway pps01524   Platinum drug resistance pps04010   MAPK signaling pathway pps04060   Cytokine-cytokine receptor interaction pps04115   p53 signaling pathway pps04210   Apoptosis pps04217   Necroptosis pps04650   Natural killer cell mediated cytotoxicity pps04668   TNF signaling pathway pps04932   Non-alcoholic fatty liver disease pps04940   Type I diabetes mellitus pps05010   Alzheimer disease pps05022   Pathways of neurodegeneration - multiple diseases pps05142   Chagas disease pps05143   African trypanosomiasis pps05160   Hepatitis C pps05161   Hepatitis B pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05200   Pathways in cancer pps05205   Proteoglycans in cancer pps05320   Autoimmune thyroid disease pps05330   Allograft rejection pps05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100988526 (FAS)    04668 TNF signaling pathway     100988526 (FAS)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100988526 (FAS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100988526 (FAS)    04217 Necroptosis     100988526 (FAS)    04115 p53 signaling pathway     100988526 (FAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100988526 (FAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100988526 (FAS)    05205 Proteoglycans in cancer     100988526 (FAS)   09163 Immune disease    05320 Autoimmune thyroid disease     100988526 (FAS)    05330 Allograft rejection     100988526 (FAS)    05332 Graft-versus-host disease     100988526 (FAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100988526 (FAS)    05022 Pathways of neurodegeneration - multiple diseases     100988526 (FAS)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100988526 (FAS)    04932 Non-alcoholic fatty liver disease     100988526 (FAS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100988526 (FAS)    05161 Hepatitis B     100988526 (FAS)    05160 Hepatitis C     100988526 (FAS)    05164 Influenza A     100988526 (FAS)    05162 Measles     100988526 (FAS)    05168 Herpes simplex virus 1 infection     100988526 (FAS)    05163 Human cytomegalovirus infection     100988526 (FAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100988526 (FAS)    05169 Epstein-Barr virus infection     100988526 (FAS)    05165 Human papillomavirus infection     100988526 (FAS)   09174 Infectious disease: parasitic    05142 Chagas disease     100988526 (FAS)    05143 African trypanosomiasis     100988526 (FAS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100988526 (FAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04050 Cytokine receptors [BR:pps04050]     100988526 (FAS)    04090 CD molecules [BR:pps04090]     100988526 (FAS) Cytokine receptors [BR:pps04050]  Tumor necrosis factor receptors   TNF receptor superfamily    100988526 (FAS) CD molecules [BR:pps04090]  Proteins   100988526 (FAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNFR_c6 Death Peptidase_C8 Motif Other DBs NCBI-GeneID:  100988526 NCBI-ProteinID:  XP_003810564 UniProt:  A0A2R9B6U6 LinkDB All DBs Position 10 AA seq 335 aa AA seqDB search MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEDLHHDGQFCH KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLWWLCLL LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKDAYDTLIKGLKK ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc aaaagtgttaatgcccaagtgactgacatcaactccaagggactggaattgaggaagact gttactacagttgagactcagaacttggaagacctgcatcatgatggccaattctgccat aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacacttacc agcaacaccaagtgcaaagaggaaggatccagatctaacttgtggtggctttgtcttctt cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga aagcacagaaaggaaaaccaaggttctcatgaatctccaaccttaaatcctgaaacagtg gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg acactaagtcaagttaaaggctttgttagaaagaatggtgtcaatgaagccaaaatagat gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat tggcatcaacttcatggaaagaaagatgcatatgacacattgattaaaggtctcaaaaaa gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

DBGET integrated database retrieval system