KEGG   Pan paniscus (bonobo): 100989574Help
Entry
100989574         CDS       T02283                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00020  Citrate cycle (TCA cycle)
pps00190  Oxidative phosphorylation
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps04714  Thermogenesis
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05010  Alzheimer's disease
pps05012  Parkinson's disease
pps05016  Huntington's disease
Module
pps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pps_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100989574 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    100989574 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    100989574 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100989574 (SDHB)
   05012 Parkinson's disease
    100989574 (SDHB)
   05016 Huntington's disease
    100989574 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100989574 (SDHB)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100989574 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100989574
NCBI-ProteinID: XP_003814497
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggcgccggttaccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatctgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system