KEGG   Pan paniscus (bonobo): 100990081Help
Entry
100990081         CDS       T02283                                 

Gene name
HK3
Definition
(RefSeq) hexokinase 3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00051  Fructose and mannose metabolism
pps00052  Galactose metabolism
pps00500  Starch and sucrose metabolism
pps00520  Amino sugar and nucleotide sugar metabolism
pps00524  Neomycin, kanamycin and gentamicin biosynthesis
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps04066  HIF-1 signaling pathway
pps04910  Insulin signaling pathway
pps04930  Type II diabetes mellitus
pps04973  Carbohydrate digestion and absorption
pps05230  Central carbon metabolism in cancer
Module
pps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100990081 (HK3)
   00051 Fructose and mannose metabolism
    100990081 (HK3)
   00052 Galactose metabolism
    100990081 (HK3)
   00500 Starch and sucrose metabolism
    100990081 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    100990081 (HK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100990081 (HK3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100990081 (HK3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100990081 (HK3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100990081 (HK3)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100990081 (HK3)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100990081 (HK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100990081 (HK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100990081 (HK3)
Membrane trafficking [BR:pps04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100990081 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF5473
Motif
Other DBs
NCBI-GeneID: 100990081
NCBI-ProteinID: XP_003806895
UniProt: A0A2R9BGC9
LinkDB All DBs
Position
5
AA seq 923 aa AA seqDB search
MDSIGSSGLRQGEEALSCSEEGLPGPSESSELVQECLQQFKVTRAQLQQIQASLLGSMEQ
ALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEP
RSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRST
LISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYSIDVVAVVNDTVGTMMGCEPGVRPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCISVEWGSFSDDGALGPVLTTFDHTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLEHVAEMEDPST
GAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSFIPSVDGGGRGVAMVTAVAARLAAHR
RLLEQTLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLA
LDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQ
SLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAI
VNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNMAGVPGDSGRMCINMEWGAFGD
DGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ
RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPHFSSLVAATVRELAPRCVVTFLQSE
DGSGKGAALVTAVACRLAQLTRV
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggactccattgggtcttcagggttgcggcagggggaagaagccctgagttgctctgag
gagggcttgcccgggccctcagagagctcagagctggtgcaggagtgcctgcagcagttc
aaggtgacaagggcacagctacagcagatccaagccagcctcttgggttccatggagcag
gcgctgaggggacaggccagccctgcccctgcggtccggatgctgcctacatacgtgggg
tccaccccacatggcactgagcaaggagacttcgtggtgctggagctgggggccacaggg
gcctcactgcgtgttttgtgggtgactctaactggcattgaggggcatagggtggagccc
agaagccaggagtttgtgatcccccaagaggtgatgctgggtgctggccagcagctcttt
gactttgctgcccactgcctgtctgagttcctggatgcgcagcctgtgaacaaacagggt
ctgcagcttggcttcagcttctctttcccttgtcaccagacgggcttggacaggagcacc
ctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccaggatgtggtccag
ctgctgagagatgccattcggaggcagggggcctacagcatcgacgtggttgctgtggtg
aacgacacagtgggcaccatgatgggctgtgagccgggggtcaggccgtgtgaggttggg
ctagttgtagacacgggcaccaacgcgtgttacatggaggaggcacggcatgtggcagtg
ctggacgaagaccggggccgcgtctgcatcagcgtcgagtggggctccttcagcgatgat
ggggcgctgggaccagtgctgaccaccttcgaccacaccctggaccatgagtccctgaat
cctggtgctcagaggtttgagaagatgatcggaggcctgtacctgggtgagctggtgcgg
ctggtgctggctcacttggcccggtgtggggtcctctttggtggctgcacctcccctgcc
ctgctgagccaaggcagcatcctcctggaacacgtggctgagatggaggacccctctact
ggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccctggggcttcggat
gttgagcttgtgcagcacgtgtgtgcggccgtgtgcacgcgggctgcccagctctgtgct
gccgccctggccgctgttctctcctgcctccagcacagccgggagcaacaaacactccag
gtcgctgtggccaccggaggccgagtgtgtgagcggcaccccaggttctgcagcgtcctg
caggggacagtgatgctcctggccccggaatgcgatgtctccttcatcccctctgtggat
ggtggtggccggggagtggcgatggtgactgccgtggctgcccgtctggctgcccaccgg
cgcctgctggagcagaccctggccccattccggttgaaccatgatcaactggctgcggtt
caggcacagatgcggaaggccatggccaaggggctccgaggggaggcctcctcccttcgc
atgctgcccactttcgtccgggccacgcctgatggcagcgagcgaggggatttcctggcc
ctggacctcgggggcacgaacttccgtgtcctcctggtacgtgtgaccacaggcgtgcag
atcaccagcgagatctactccattcccgagactgtggcccagggttctgggcagcagctc
tttgaccacatcgtggactgcatcgtggacttccagcagaagcagggcctgagcgggcag
agcctcccactgggttttaccttctccttcccatgtaggcagcttggcctggaccagggc
atcctcctgaactggaccaagggtttcaaggcatcagactgcgagggccaagacgtcgtg
agtctgttgcgggaagccatcacgcgcagacaggcagtggagctgaatgtggttgccatt
gtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccccgttgcgagata
ggcctcattgtcggaaccggcaccaatgcctgctacatggaggagctccggaatatggcg
ggcgtgcctggggactcaggccgcatgtgcatcaacatggagtggggcgcctttggggac
gatggctctctggccatgctcagcacccgctttgatgcaagtgtggaccaggcgtccatc
aaccccggcaagcagaggtttgaaaagatgatcagcggcatgtacctgggggagatcgtc
cgccacatccttttacatttaaccagccttggcgttctcttccggggccagcagatccag
cgccttcagaccagggacatcttcaagaccaagttcctctctgagatcgaaagtgacagc
ctggccctgcggcaggtccgagccatcctagaggatctggggctacccctgacctcagat
gacgccctgatggtgctagaggtgtgccaggctgtgtcccagcgggctgcccagctctgt
ggggcgggtgtagctgccgtggtggagaagatccgggagaaccggggcctggaagagctg
gcagtgtctgtgggggtggatggaacgctctacaagctgcacccgcacttctccagcctg
gtggcggccacggtgcgggagctggcccctcgctgtgtggtcacgttcctgcagtcagag
gatgggtccggcaaaggtgcagccctggtcactgctgttgcctgccgccttgcgcagttg
actcgtgtctga

DBGET integrated database retrieval system