KEGG   Pan paniscus (bonobo): 100991392Help
Entry
100991392         CDS       T02283                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
pps04972  Pancreatic secretion
pps04974  Protein digestion and absorption
pps05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100991392 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100991392 (PRSS2)
   04974 Protein digestion and absorption
    100991392 (PRSS2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100991392 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pps01002]
    100991392 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100991392 (PRSS2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100991392 (PRSS2)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100991392 (PRSS2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100991392 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100991392
NCBI-ProteinID: XP_003820609
UniProt: A0A2R9CSV7
LinkDB All DBs
Position
7
AA seq 261 aa AA seqDB search
MHMRETNVFTLKKGRSAPLVFHPPDALIAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYH
FCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDN
DILLIKLSTPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVL
SQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatgtcttcacattgaagaaggggaggagtgcgccattggtt
ttccatcctccagatgcactgattgctgccccctttgatgatgatgacaagatcgttggg
ggctatacctgtgaggagaattctgtcccctaccaggtgtccttgaattctggctaccac
ttctgcggtggctccctcatcagcgaacagtgggtggtgtcagcaggtcactgctacaag
tcccgcatccaggtgagactgggagagcacaacatcgaagtcctggaggggaatgaacag
ttcatcaatgcggccaagatcatccgccaccccaaatacaacagccggactctggacaat
gacatcctgctgatcaagctctccacacctgccgtcatcaactcccgcgtgtccgccatc
tctctgcccactgcccctccagctgctggcaccgagtccctcatctccggctggggcaac
actctgagttctggtgccgactacccagacgagttgcagtgcctggatgctcctgtgctg
agccaggctgagtgtgaagcctcctaccctggaaagattaccaacaacatgttctgtgtg
ggcttcctcgagggaggcaaggattcctgccagggtgattctggtggccctgtggtctcc
aatggagagctccaaggaattgtctcctggggctatggctgtgcccagaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system