KEGG   Pan paniscus (bonobo): 100991521
Entry
100991521         CDS       T02283                                 

Gene name
RIPK1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04668  TNF signaling pathway
pps05132  Salmonella infection
pps05160  Hepatitis C
pps05163  Human cytomegalovirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100991521 (RIPK1)
   04668 TNF signaling pathway
    100991521 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100991521 (RIPK1)
   04217 Necroptosis
    100991521 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100991521 (RIPK1)
   04621 NOD-like receptor signaling pathway
    100991521 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    100991521 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    100991521 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100991521 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100991521 (RIPK1)
   05160 Hepatitis C
    100991521 (RIPK1)
   05163 Human cytomegalovirus infection
    100991521 (RIPK1)
   05169 Epstein-Barr virus infection
    100991521 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991521 (RIPK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100991521 (RIPK1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   100991521 (RIPK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death RHIM Pkinase_fungal RIO1 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100991521
NCBI-ProteinID: XP_003805603
UniProt: A0A2R8ZZE3
LinkDB
Position
6
AA seq 671 aa
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTARKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFGSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagt
gcagaactggacagcggaggcttcgggaaggtgtctctgtgtttccacagaacccaggga
ctcatgatcatgaaaacagtgtacaaggggcccaactgcattgagcacaacgaggccctc
ttggaggaggcgaagatgatgaacagactgagacacagccgggtggtgaagctcctgggc
gtcatcatagaggaagggaagtactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttctgtaaaaggaaggataattttg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgataatgacttccacattaagatcgcagacctcggccttgcc
tcctttaagatgtggagcaaactgaataatgaagagcacaatgagctgagggaagtggac
ggcaccgctaggaagaatggcggcaccctctactacatggcgcccgagcacctgaatgac
gtcaacgcaaagcccacagagaagtcggatgtgtacagctttgctgtagtactctgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagttgataatgtgc
ataaaatctgggaacaggccagatgtggatgacatcactgagtactgcccaagagaaatt
atcagtctcatgaagctctgctgggaagcgaatccggaagctcggccaacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggac
gtgaagagtttaaagaaagagtattcaaacgaaaatgcagttgtgaagagaatgcagtct
cttcaacttgattgtgtggcagtaccttcaagccggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgcc
ccctccctggagcacccacaagaagagaatgagcccagcctgcagagtaaactccaagac
gaagccaactaccatctttatggcagccgcatggacaggcagacgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgcagggtctcccatgaccctttt
gcacagcaaagaccttacgagaattttcagaatacggagggaaaaggcactgcttattcc
agtgcagccagtcatggtaatgcagtgcaccagccctcagggctcaccagccaacctcaa
gtactgtatcagaacaatggattatatagctcacatggctttggaacaagaccactggat
ccaggaacagcaggtcccagagtttggtacaggccaattccaagtcatatgcctagtctg
cataatatcccagtgcctgagaccaactatctaggaaatacacccaccatgccattcggc
tccttgccaccaacagatgaatctataaaatataccatatacaatagtactggcattcag
attggagcctacaattatatggagattggtgggacgagttcatcactactagacagcaca
aatacgaacttcaaagaagagccagctgctaagtaccaagctatctttgataataccact
agtctgacggataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccgtaaactgggcttcacacaatctcagattgatgaaattgaccatgactatgag
cgagatggactaaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
attaaaggagccacagtggggaagctggcccaggcgctccaccagtgttccaggatcgac
cttctgagcagcttgatttacgtcagccagaactaa

DBGET integrated database retrieval system