KEGG   Pan paniscus (bonobo): 100991820
Entry
100991820         CDS       T02283                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04071  Sphingolipid signaling pathway
pps04115  p53 signaling pathway
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04722  Neurotrophin signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100991820 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100991820 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100991820 (BAX)
   04215 Apoptosis - multiple species
    100991820 (BAX)
   04217 Necroptosis
    100991820 (BAX)
   04115 p53 signaling pathway
    100991820 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100991820 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100991820 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991820 (BAX)
   05202 Transcriptional misregulation in cancer
    100991820 (BAX)
   05203 Viral carcinogenesis
    100991820 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100991820 (BAX)
   05212 Pancreatic cancer
    100991820 (BAX)
   05225 Hepatocellular carcinoma
    100991820 (BAX)
   05226 Gastric cancer
    100991820 (BAX)
   05214 Glioma
    100991820 (BAX)
   05216 Thyroid cancer
    100991820 (BAX)
   05220 Chronic myeloid leukemia
    100991820 (BAX)
   05217 Basal cell carcinoma
    100991820 (BAX)
   05218 Melanoma
    100991820 (BAX)
   05213 Endometrial cancer
    100991820 (BAX)
   05224 Breast cancer
    100991820 (BAX)
   05222 Small cell lung cancer
    100991820 (BAX)
   05223 Non-small cell lung cancer
    100991820 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100991820 (BAX)
   05014 Amyotrophic lateral sclerosis
    100991820 (BAX)
   05016 Huntington disease
    100991820 (BAX)
   05020 Prion disease
    100991820 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100991820 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100991820 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100991820 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100991820 (BAX)
   05152 Tuberculosis
    100991820 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991820 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100991820 (BAX)
   05161 Hepatitis B
    100991820 (BAX)
   05160 Hepatitis C
    100991820 (BAX)
   05164 Influenza A
    100991820 (BAX)
   05162 Measles
    100991820 (BAX)
   05168 Herpes simplex virus 1 infection
    100991820 (BAX)
   05163 Human cytomegalovirus infection
    100991820 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100991820 (BAX)
   05169 Epstein-Barr virus infection
    100991820 (BAX)
   05165 Human papillomavirus infection
    100991820 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100991820 (BAX)
   01524 Platinum drug resistance
    100991820 (BAX)
   01522 Endocrine resistance
    100991820 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100991820 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100991820 (BAX)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100991820 (BAX)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100991820 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100991820
NCBI-ProteinID: XP_003814343
UniProt: A0A2R9BX16
LinkDB
Position
19
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system