Pan paniscus (bonobo): 100992611 Help Entry 100992611         CDS       T02283                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05202   Transcriptional misregulation in cancer pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100992611  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100992611   09163 Immune disease    05322 Systemic lupus erythematosus     100992611   09165 Substance dependence    05034 Alcoholism     100992611  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     100992611   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     100992611 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100992611 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100992611 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100992611 NCBI-ProteinID:  XP_003827504 LinkDB All DBs Position 13:52904443..52905519 Genome browser AA seq 136 aa AA seqDB search MAGTKPTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRNRPGTVALREVRRYQKSTE LLIRKLPSQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGFFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctggtacaaagccgactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgtaacaggcctggtactgtggcgctccgtgaagttagacgttatcagaagtccactgaa cttctgattcgcaaacttccctcccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat ctggttggcttttttgaagacactaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system