KEGG   Pan paniscus (bonobo): 100993334
Entry
100993334         CDS       T02283                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04022  cGMP-PKG signaling pathway
pps04141  Protein processing in endoplasmic reticulum
pps04151  PI3K-Akt signaling pathway
pps04211  Longevity regulating pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04668  TNF signaling pathway
pps04728  Dopaminergic synapse
pps04911  Insulin secretion
pps04915  Estrogen signaling pathway
pps04918  Thyroid hormone synthesis
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps05020  Prion disease
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05034  Alcoholism
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100993334 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100993334 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100993334 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100993334 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100993334 (ATF6B)
   04915 Estrogen signaling pathway
    100993334 (ATF6B)
   04926 Relaxin signaling pathway
    100993334 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100993334 (ATF6B)
   04918 Thyroid hormone synthesis
    100993334 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100993334 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100993334 (ATF6B)
   04927 Cortisol synthesis and secretion
    100993334 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100993334 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100993334 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100993334 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100993334 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100993334 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100993334 (ATF6B)
   05031 Amphetamine addiction
    100993334 (ATF6B)
   05034 Alcoholism
    100993334 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100993334 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100993334 (ATF6B)
   05161 Hepatitis B
    100993334 (ATF6B)
   05163 Human cytomegalovirus infection
    100993334 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100993334 (ATF6B)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100993334 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 100993334
NCBI-ProteinID: XP_003829825
LinkDB
Position
6
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SEALGVGEVLHVKAESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCS
SVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGS
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKMVCIMVFLLFIAFNFG
PVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQP
SFSNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPFYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgctgac
ccgacgcgtttcttcaccgacaacctgcttagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctctttcgttgcccg
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccaatcttcccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctccctcagctccgagtcatcgcgtctctccacagagccatcc
agcgaggctcttggggtaggggaggtgctccatgtgaaggcagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgttatc
cccacctctgatgattcctcagatgtccagaccaagatagaacctgtctctccatgttct
tccgtcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctgtccccttcaggatgcctcctttgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccttgatggctcc
tcagggaaagccctgcccacccggaagccaccactgcagcccaaacctgtagtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctc
gtccagccacccccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctccctctctaccacggcctgagaggaagagcatcgttcccgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggga
ctggaggctcggctgcaagcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaagatggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cctgtcagcatcagtgagcctccttcagctcccatctctcctcggatgaacaagggggag
cctcaaccccggagacacttgctggggttctcggagcaagagccagttcagggagttgaa
cctctccaggggtcctcccagggccctaaggagccccagcccagccccacagaccagccc
agtttcagcaacctgacagccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcactgagtccctgaggctt
gctgacgagttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcaactatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacattt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacagtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccag
gcctcccaccagcccttctacctcaatcatccctga

DBGET integrated database retrieval system