KEGG   Pan paniscus (bonobo): 100995372Help
Entry
100995372         CDS       T02283                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100995372 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100995372 (KMT5B)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100995372 (KMT5B)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100995372 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100995372
NCBI-ProteinID: XP_008952429
UniProt: A0A2R9BT57
LinkDB All DBs
Position
11
AA seq 885 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLDGYKSSVTEPCPDSGEQPQPAPVLQEEELAHETAQKGEA
KCHKSDTGMSKKKSRQGKLVKQFAKIEESTPVHDSPGKDDAVPDLMGPHSDQGEHSGTVG
VPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTL
RRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQ
LKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccctg
aaggctggcaaaaatgcagtcgagaggaggtcgaacagatgtaatggtaactcgggattt
gaaggacagagtcgctatgtaccatcctctggaatgtccgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtgagatttaggcctattaaaggaaggcaggaagaactaaaggaagta
attgaacgttttaagaaagatgaacacttggagaaagccttcaaatgtttgacttcaggc
gaatgggcacggcactattttctcaacaagaataaaatgcaggagaaattattcaaagaa
catgtatttatttatttgcgaatgtttgcaacggacagtggatttgaaatattgccatgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtactccacaaggaaaaactgt
gctcaactctggctgggtcctgctgcgtttataaaccatgattgcagacctaattgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctaagagacattgaacctgga
gaagaaatttcttgttattatggagatgggttctttggagaaaataatgagttctgcgag
tgttacacttgcgaaagacggggcactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggc
gtaaaaaagaatagcaagagcagaacgttaacgaggcaatctatgtcaagaattccagct
tcttccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaa
ctgaagaagcctgcaaagcctttactttcaaagataaaattgagaaatcattgcaagcgg
ctggagcaaaagaatgcttcaagaaaactcgaaatgggaaacttagtactgaaagagcct
aaagtagttctatataaaaatttgcccattaaaaaagataaggagccagagggaccagcc
caagccgcagttgccagcgggtgcttgactagacacgcggcgagagaacacagacagaat
cctgtgagaggtgctcattcgcagggggagagctcgccctgcacctacataactcggcgg
tcagtgaggacaagaacaaatctgaaggaggcctctgacatcaagcttgaaccaaatacg
ttggatggctataaaagcagtgtgacggaaccttgccccgacagtggtgaacagccgcag
ccagctcctgtgctgcaggaggaagaactggctcatgagactgcacaaaaaggggaggca
aagtgtcataagagtgacacaggcatgtccaaaaagaagtcacgacaaggaaaacttgtg
aaacagtttgcaaaaatagaggaatctactccagtgcacgactctcctggaaaagacgac
gcggtaccagatttgatgggtccccattctgaccagggtgagcacagtggcactgtgggc
gtgcctgtgagctacacagactgtgctccttcacccgtcggttgttcagttgtgacatca
gatagcttcaaaacaaaagacagctttagaactgcaaaaagtaaaaagaagaggcgaatc
acaaggtatgacgcacagttaatcctagaaaataactctgggattcccaaattgactctt
cgtaggcgtcatgatagcagcagcaaaacaaatgaccaagagaatgatggaatgaactct
tccaaaataagcatcaagttaagcaaagaccatgacaacgataacaatctctatgtagca
aagcttaataatggatttaactcaggatcaggcagtagttctacaaaattaaaaatccag
ctaaaacgagatgaggaaaatagggggtcttatacagaggggcttcatgaaaatggggtg
tgctgcagtgatcctctttctctcttggagtctcgaatggaggtggatgactatagtcag
tatgaggaagaaagtacagatgattcctcctcttctgagggcgatgaagaggaggatgac
tatgatgatgactttgaagacgattttattcctcttcctccagctaagcgcttgaggtta
atagttggaaaagactctatagatattgacatttcttcaaggagaagagaagatcagtct
ttaaggcttaatgcctaa

DBGET integrated database retrieval system