KEGG   Pan paniscus (bonobo): 100995605
Entry
100995605         CDS       T02283                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04340  Hedgehog signaling pathway
pps04371  Apelin signaling pathway
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04530  Tight junction
pps04630  JAK-STAT signaling pathway
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100995605 (CCND1)
   04340 Hedgehog signaling pathway
    100995605 (CCND1)
   04390 Hippo signaling pathway
    100995605 (CCND1)
   04371 Apelin signaling pathway
    100995605 (CCND1)
   04630 JAK-STAT signaling pathway
    100995605 (CCND1)
   04068 FoxO signaling pathway
    100995605 (CCND1)
   04151 PI3K-Akt signaling pathway
    100995605 (CCND1)
   04152 AMPK signaling pathway
    100995605 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100995605 (CCND1)
   04115 p53 signaling pathway
    100995605 (CCND1)
   04218 Cellular senescence
    100995605 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100995605 (CCND1)
   04530 Tight junction
    100995605 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100995605 (CCND1)
   04921 Oxytocin signaling pathway
    100995605 (CCND1)
   04919 Thyroid hormone signaling pathway
    100995605 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995605 (CCND1)
   05206 MicroRNAs in cancer
    100995605 (CCND1)
   05205 Proteoglycans in cancer
    100995605 (CCND1)
   05203 Viral carcinogenesis
    100995605 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100995605 (CCND1)
   05212 Pancreatic cancer
    100995605 (CCND1)
   05225 Hepatocellular carcinoma
    100995605 (CCND1)
   05226 Gastric cancer
    100995605 (CCND1)
   05214 Glioma
    100995605 (CCND1)
   05216 Thyroid cancer
    100995605 (CCND1)
   05221 Acute myeloid leukemia
    100995605 (CCND1)
   05220 Chronic myeloid leukemia
    100995605 (CCND1)
   05218 Melanoma
    100995605 (CCND1)
   05219 Bladder cancer
    100995605 (CCND1)
   05215 Prostate cancer
    100995605 (CCND1)
   05213 Endometrial cancer
    100995605 (CCND1)
   05224 Breast cancer
    100995605 (CCND1)
   05222 Small cell lung cancer
    100995605 (CCND1)
   05223 Non-small cell lung cancer
    100995605 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100995605 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100995605 (CCND1)
   04934 Cushing syndrome
    100995605 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995605 (CCND1)
   05162 Measles
    100995605 (CCND1)
   05160 Hepatitis C
    100995605 (CCND1)
   05163 Human cytomegalovirus infection
    100995605 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995605 (CCND1)
   05169 Epstein-Barr virus infection
    100995605 (CCND1)
   05165 Human papillomavirus infection
    100995605 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100995605 (CCND1)
SSDB
Motif
Pfam: Cyclin_C SAM_KSR1
Other DBs
NCBI-GeneID: 100995605
NCBI-ProteinID: XP_008952459
LinkDB
Position
11
AA seq 163 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKETFVALCATD
VKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIE
ALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 492 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggagaccttcgttgccctctgtgccacagat
gtgaagttcatttccaatccgccctccatggtggcagcggggagcgtggtggccgcagtg
caaggcctgaacctgaggagccccaacaacttcctgtcctactaccgcctcacacgcttc
ctctccagagtgatcaagtgtgacccggactgcctccgggcctgccaggagcagatcgaa
gccctgctggagtcaagcctgcgccaggcccagcagaacatggaccccaaggccgccgag
gaggaggaagaggaggaggaggaggtggacctggcttgcacacccaccgacgtgcgggac
gtggacatctga

DBGET integrated database retrieval system