KEGG   Pan paniscus (bonobo): 100996159
Entry
100996159         CDS       T02283                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100996159 (MYD88)
   04064 NF-kappa B signaling pathway
    100996159 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100996159 (MYD88)
   04621 NOD-like receptor signaling pathway
    100996159 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100996159 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100996159 (MYD88)
   05135 Yersinia infection
    100996159 (MYD88)
   05133 Pertussis
    100996159 (MYD88)
   05134 Legionellosis
    100996159 (MYD88)
   05152 Tuberculosis
    100996159 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100996159 (MYD88)
   05161 Hepatitis B
    100996159 (MYD88)
   05171 Coronavirus disease - COVID-19
    100996159 (MYD88)
   05164 Influenza A
    100996159 (MYD88)
   05162 Measles
    100996159 (MYD88)
   05168 Herpes simplex virus 1 infection
    100996159 (MYD88)
   05169 Epstein-Barr virus infection
    100996159 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    100996159 (MYD88)
   05145 Toxoplasmosis
    100996159 (MYD88)
   05140 Leishmaniasis
    100996159 (MYD88)
   05142 Chagas disease
    100996159 (MYD88)
   05143 African trypanosomiasis
    100996159 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 100996159
NCBI-ProteinID: NP_001266118
UniProt: B3Y679
LinkDB
Position
3
AA seq 296 aa
MAAGGPGAGSAAPISSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcaggaggtcccggcgcggggtctgcggccccgatctcctccacatcctccctt
cccctggctgctctcaacatgcgagtgcggcgccgcctgtctctgttcttgaacgtgcgg
acacaggtggcggccgactggaccgcgctggcggaggagatggactttgagtacttggag
atccggcaactggagacacacgcggaccccactggcaggctgctggacgcctggcaggga
cgccctggcgcctcggtaggccgactgcttgagctgcttaccaagctgggccgcgacgac
gtgctgctggagctgggacccagcattgaggaggattgccaaaagtatatcttgaagcag
cagcaggaggaggctgagaagcctttacaggtggccgctgtagacagcagtgtcccacgg
acagcagagctggcgggcatcaccacacttgatgaccccctggggcatatgcctgagcgt
ttcgatgccttcatctgctattgccccagcgacatccagtttgtgcaggagatgatccgg
caactggaacagacaaactatcgactgaagttgtgtgtgtctgaccgcgatgtcctgcct
ggcacctgtgtctggtccattgctagtgagctcatcgaaaagaggtgccgccggatggtg
gtggttgtctctgatgattacctgcagagcaaggaatgtgactttcagaccaaatttgca
ctcagcctctctccaggtgcccatcagaagcgactgatccccatcaagtacaaggcaatg
aagaaagagttccccagcatcctgaggttcatcactgtctgcgactacaccaacccctgc
accaaatcttggttctggactcgccttgccaaggccttgtccctgccctga

DBGET integrated database retrieval system