KEGG   Pan paniscus (bonobo): 100996199Help
Entry
100996199         CDS       T02283                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00052  Galactose metabolism
pps00500  Starch and sucrose metabolism
pps01100  Metabolic pathways
pps04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100996199 (MGAM)
   00500 Starch and sucrose metabolism
    100996199 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100996199 (MGAM)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100996199 (MGAM)
    3.2.1.20  alpha-glucosidase
     100996199 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Cornifin
Motif
Other DBs
NCBI-GeneID: 100996199
NCBI-ProteinID: XP_003813563
LinkDB All DBs
Position
7
AA seq 2270 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHPRTTGPPDPGTTATTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHMEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHVQSFSGNAASSLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDPVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQSVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPRDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNHLEVNISQLTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSIYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSMPSSTPEG
QLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTGKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
EDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRKNPLGLIIAL
DENKEAKGELFWDDGQTKDTVANKVYLLCEFSVTQNHLEVNISQSTYKDPNNLAFNEIKI
LGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDINLFLGEAYTVEWSIKIRDEEKI
DCYPDENGASAENCTARGCIWEASNSSGVPFCYFVDDLYSVSDVQYNSHGATADISLKSS
VHANAFPSTPVNPLRLHVTYQKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQLYD
VLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHRSYRR
DLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALT
YRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNNSEIASLYD
EMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNE
TQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVE
NT seq 6810 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtaccccagatcctgggacaactggtacccca
gatcctggaacaactggtaccacacatcctaggacaacgggtcccccagatcctggaaca
actgctaccactcctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaat
tgcatccctgaccagccgccaacaaaggccacatgtgaccaacgtggctgttgctggaat
ccccagggagctgtaagtgttccctggtgctactattccaagaatcatagctaccacatg
gagggcaaccttgtcaacacaaatgcaggattcacagcccggttgaaaaatctgccttct
tcacccgtgtttggaagcaatgttgacaatgttcttctcacagcagaatatcagacatct
aatcgtttccactttaagttgactgaccaaaccaataataggtttgaagtgccccacgaa
cacgtgcagtccttcagtggaaatgctgcttcttctttgacctaccaagttgaaatctcc
agacagccatttagcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactcg
agcattgggcccctactgtttgccgaccagttcttgcagctctccactcgactgcctagc
gctaacgtgtatggcctgggagagcatgtgcaccagcagtatcggcatgatatgaattgg
aagacctggcccatatttaacagagacacaactcccaatggaaacggaactaatttgtat
ggtgcgcagacattcttcttgtgccttgaagatgctagtggattgtcctttggggtgttt
ctgatgaacagcaatgccatggaggttgtccttcagcctgcgccagccatcacttaccgc
accattgggggcattctcgacttctatgtgttcttgggaaacactccagagcaagttgtt
caagaatatctagagcttattgggcggccagcccttccctcctactgggcgcttggattt
cacctcagtcgttacgaatatggaaccttagacaacatgagggaagtcgtggagagaaat
cgcgcagcacagctcccttatgatgttcagcatgctgatattgattatatggatgagaga
agggacttcacttacgatccagtggattttaaaggcttccctgaatttgtcaacgagtta
cacaataatggacagaagcttgtcatcattgtggatccagccatctccaacaactcttcc
tcaagtaaaccctatggcccatatgacaggggttcagatatgaagatatgggtgaatagt
tcagatggagtgactccactcattggggaggtctggcctggacaaagtgtgtttcctgat
tataccaatcccaactgtgctgtttggtggacaaaggaatttgagctttttcacaatcaa
gtagagtttgatggaatctggattgatatgaatgaagtctccaactttgttgatggttcg
gtctcaggatgttccacaaacaacctaaataatcccccattcactcccagaatcctggat
gggtacctgttctgcaagactctctgtatggatgcagtgcagcactggggcaagcagtat
gacgttcacaatctgtatggctactccatggcggtcgccacagcagaagctgccaagact
gtgttccctaataagagaagcttcattctgacccgttctacctttgcgggctctggcaag
tttgcagcacattggttaggagacaacactgccacctgggacgacctgagatggtccatc
cctggcgtgcttgagttcaacctttttggcatcccaatggtgggtcctgacatatgtggc
tttgctttggacacccctgaggagctctgtaggcggtggatgcagttgggtgcattttat
ccgttttctagaaatcacaatggccaaggctacaaggaccaggatcctgcctcctttgga
gctgactccctgctgttgaattcctccaggcactaccttaacatccgctatactctattg
ccctacctatacaccctcttcttccgtgctcacagccgaggggacacagtggccaggccc
cttttgcatgagttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgg
gggcccggtctcctcatcactccagttctggatgaaggtgcagagaaagtgatggcatat
gtgcctgatgctgtctggtatgactacgagactgggagccaagtgagatggaggaagcaa
aaagtcgagatggaacttcctagagacaaaattggacttcaccttcgaggaggctacatc
ttccccacacagcagccaaatacaaccactctggccagtcgaaagaaccctcttggtctt
atcattgccctagatgaaaacaaagaagcaaaaggagaacttttctgggatgatggggaa
acgaaggatactgtggccaataaagtgtatcttttatgtgagttttctgtcactcaaaac
cacttggaggtgaatatttcacaattaacctacaaggaccccaataatttagcattcaat
gagattaaaattcttgggacggaggaaccaagcaatgttacggtgaaacacaatggtgtc
ccaagtcagacttctcctacagtcacttatgattctaacctgaaggttgccattatcaca
gatatcgatcttctcctgggagaagcatacacagtggaatggagcataaagataagggat
gaagaaaaaatagactgttaccctgatgagaatggtgcttctgcagaaaactgcactgcc
cgtggctgtatctgggaggcatccaattcttctggagtccctttttgctattttgtcaac
gacctatactctgtcagtgatgttcagtataattcccatggggccacagctgacatctcc
ttaaagtcttccatttatgccaatgctttcccctccacacccgtgaacccccttcgcctg
gatgtcacttaccataagaatgaaatgctgcagttcaagatttatgatcccaacaacaat
cggtatgaagttccagtccctctgaacatacccagcatgccatccagcacccctgagggt
caactctatgatgtgctcattaagaagaatccatttgggattgaaattcgccggaagagt
acaggcactataatttgggactctcagctccttggcttcaccttcagtgacatgtttatc
cgcatctccacccgccttccctccaagtacctctatggctttggggaaactgagcacagg
tcctataggagagacttggagtggcacacttgggggatgttctcccgagaccagccccca
gggtacaagaagaattcctatggtgtccacccctactacatggggctggaggaggacggc
agtgcccatggagtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctg
cctgccttgacataccgcaccacagggggagttctggacttttatgtgttcttggggccg
actccagagcttgtcacccagcagtacactgagttgattggccggcctgtgatggtacct
tactggtctttggggttccagctgtgtcgctatggataccagaacgactctgagatcgcc
agcttgtatgatgagatggtggctgcccagatcccttatgacgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaggctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccctatcctgccttcactcggggcgtggaggatgacgtcttc
atcaagtacccaaatgatggagacattgtctggggaaaggtctggcctgattttcctgat
gttgttgtgaatgggtctctagactgggacagccaagtggagctatatcgagcttatgtg
gccttcccagactttttccgtaattcaactggcaagtggtggaagagggaaatagaagaa
ctatacaacaatccacagaatccagagaggagcttgaagtttgatggcatgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctct
ctgaaccaccctccctacatgccacatttggagtctagggacaggggcctgagcagcaag
accctttgcatggagagtcagcagatcctcccagatggctccccggtgcagcactacaat
gtgcacaacctgtacgggtggtcccagaccagacccacatacgaagctgtgcaggaggtg
acaggacagcgaggggtcgtcatcacccgctccacatttccctcttctggccgctgggca
ggacattggctgggagacaacacggccgcgtgggatcagctgaagaaatctatcattggc
atgatggagttcagcctcttcggcatatcctatacgggagcagatatctgtgggttcttt
gaagatgctgaatatgagatgtgtgttcgctggatgcagctgggggccttttaccccttc
tcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgctgct
tttgtgaacatttccagaactgtcctgcagaccagatacaccctgttgccatatctgtat
accttgatgcataaggcccacacggagggcgtcactgttgtgcgacctctgctccatgag
tttgtgtcagaccaggtgacatgggacatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcctggagcgcaatgccagaaatgtcactgcatatttccctagagcc
cgttggtacgattactacacgggtgtggatattaatgcaagaggagagtggaagaccttg
ccagcccctcttgaccacattaatcttcatgtccgtgggggctacatcttgccctggcaa
gagcctgcactgaacacccacttaagtcgaaagaaccctcttggtcttattattgcccta
gatgaaaacaaagaagcaaaaggagaacttttctgggatgatgggcaaacaaaggatact
gtggccaataaagtatatcttttatgtgagttttctgtcactcaaaaccacttggaggtg
aatatttcacaatcaacctacaaggaccccaataatttagcattcaatgagattaaaatt
cttgggacggaggaaccaagcaatgttacggtgaaacacaatggtgtcccaagtcagact
tctcctacagtcacttatgattctaacctgaaggtcgccattatcacagacatcaatctt
ttcctgggagaagcatacacagtggagtggagcataaagataagggatgaagaaaaaata
gactgttaccctgatgagaatggtgcttctgcagaaaactgcactgcccgtggctgtatc
tgggaggcatccaattcttctggagtccctttttgctattttgtcgatgacctatactct
gtcagtgatgttcagtataactcccatggggccacagctgacatctccttaaagtcttct
gttcatgccaatgccttcccttccacacccgtgaacccccttcgcctgcatgtcacttac
caaaagaatgaaatgctgcagttcaagatttatgatcccaacaacaatcggtatgaagtt
ccagtccctctgaacatacccagtgtgccatccagcacccctgagggtcaactctatgat
gtcctcattaagaagaatccatttgggattgaaattcgccggaagagtacaggcactata
atttgggactctcagctccttggcttcaccttcaatgacatgtttatccgcatctccacc
cgccttccctccaagtacctctatggctttggggaaactgagcacaggtcctataggaga
gacttggagtggcacacttgggggatgttctcccgagaccagcccccagggtacaagaag
aattcctatggtgtccacccctactacatggggctagaggaggacggcagtgcccatgga
gtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctgcctgccttgaca
taccgtaccacagggggagttctggacttttatgtgttcttggggccaactccagagctt
gtcacccagcagtacactgagttgattggccggcctgtgatggtaccttactggtctttg
gggttccagctgtgtcgctatggataccagaacaattctgagatcgccagcttgtatgat
gagatggtggctgcccagatcccttatgatgtgcagtactcagacatcgactacatggag
cggcagctggacttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgc
atgaaggctgatgggatgcgggtcatcctcattctggatccagccatttctggcaatgag
acacagccttatcctgccttcactcggggcgtggaggatgacgtcttcatcaagtaccca
aatgatggagacattgtctggggaaaggtctggcctgattttcctgatgttgttgtgaat
gggtctctagactgggacagtcaagtggag

DBGET integrated database retrieval system