KEGG   Pan paniscus (bonobo): 103784428Help
Entry
103784428         CDS       T02283                                 

Definition
(RefSeq) actin, alpha skeletal muscle-like
  KO
K05692  actin beta/gamma 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04145  Phagosome
pps04210  Apoptosis
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04611  Platelet activation
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04810  Regulation of actin cytoskeleton
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05164  Influenza A
pps05205  Proteoglycans in cancer
pps05225  Hepatocellular carcinoma
pps05410  Hypertrophic cardiomyopathy (HCM)
pps05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pps05414  Dilated cardiomyopathy (DCM)
pps05416  Viral myocarditis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103784428
   04390 Hippo signaling pathway
    103784428
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103784428
  09143 Cell growth and death
   04210 Apoptosis
    103784428
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103784428
   04520 Adherens junction
    103784428
   04530 Tight junction
    103784428
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103784428
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103784428
   04670 Leukocyte transendothelial migration
    103784428
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103784428
   04919 Thyroid hormone signaling pathway
    103784428
  09159 Environmental adaptation
   04714 Thermogenesis
    103784428
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103784428
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103784428
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103784428
   05410 Hypertrophic cardiomyopathy (HCM)
    103784428
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    103784428
   05414 Dilated cardiomyopathy (DCM)
    103784428
   05416 Viral myocarditis
    103784428
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103784428
   05135 Yersinia infection
    103784428
   05100 Bacterial invasion of epithelial cells
    103784428
  09172 Infectious disease: viral
   05164 Influenza A
    103784428
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    103784428
   03019 Messenger RNA biogenesis [BR:pps03019]
    103784428
   03036 Chromosome and associated proteins [BR:pps03036]
    103784428
   03029 Mitochondrial biogenesis [BR:pps03029]
    103784428
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    103784428
   04147 Exosome [BR:pps04147]
    103784428
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     103784428
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103784428
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     103784428
    NuA4 complex
     103784428
  Chromatin remodeling factors
   BAF complex
    103784428
   PBAF complex
    103784428
   SWR1 complex
    103784428
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    103784428
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     103784428
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   103784428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 103784428
NCBI-ProteinID: XP_008958832
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MVQRTATADDIKLEKSYKLPDSQVITISNERFRCPEVLFQPSFLGMESCGTHKTTFNCIM
KCDVDISKDLYANTVLSSGTTMYPDITNRMQKAITALAPSTMKIKIIAPRERKYSVWIGG
SILASMSTFQQMCTSKQEYDKLESSTVHHKCF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaagaacagctacagctgatgacataaagctggagaagagctacaagctgccc
gacagccaggtcatcaccatcagcaacgaacggttccggtgtccggaggtgctgttccag
ccttccttcctgggcatggaatcctgtggcacccacaagaccaccttcaactgcatcatg
aagtgtgatgtggacatctccaaagacctgtacgccaacacagtgctgtccagcggcacc
accatgtacccagacatcaccaacaggatgcagaaggcaatcactgccctggcacctagc
accatgaagatcaagatcattgcaccccgagagcgaaagtactcggtgtggatcggcggc
tccatcctggcctcaatgtccaccttccagcagatgtgcactagcaagcaggagtatgac
aagttggagtcctccactgttcaccacaaatgcttctaa

DBGET integrated database retrieval system