KEGG   Paenibacillus psychroresistens: EHS13_00020
Entry
EHS13_00020       CDS       T06328                                 

Gene name
recF
Definition
(GenBank) DNA replication/repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_00020 (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00020 (recF)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_00020 (recF)
SSDB
Motif
Pfam: SMC_N AAA_15 AAA_23 AAA_21 AAA_27 AAA_29 SbcCD_C
Other DBs
NCBI-ProteinID: QGQ93431
UniProt: A0A6B8R8M1
LinkDB
Position
2865..3977
AA seq 370 aa
MFLNRLALQNYRNIEQFDLQLDSKVNLFVGPNAQGKTNILEAIYVLALTKSHRTNQDKEL
IRWNETQTIMHGEIDKKYGVNQLHLVISQQGKKAKINGLEQKKLSQFIGTLNVVLFAPED
LEIVKGSPGTRRRFLDMELGQVYPRYLHDIMQYQKILVQRNNYLKQLIQQKNINYEMLEV
WNEQLVNFGVKIVKKRQSFIKKLQIWAERVHSGITNQRELMTIEYLPSFDLQGSEDETVI
FEQFMVKLKHVKEQEIRRGVTLVGPHRDDMLFFINGKEVQQYGSQGQQRTTALSLKLAEL
ELIHEEVGEYPILLLDDVLSELDQYRQTQLIETFQNKVQTFITTTSIESINLSKLSDAAI
FKVRNGSIER
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtttttgaacaggcttgctttgcagaattatcgcaatatcgaacaatttgatttgcag
ctggatagcaaagttaatctatttgttggccctaatgcgcaaggtaaaaccaacatcctt
gaagcaatctatgtactggctttaacgaaatcacatcggaccaatcaagataaagaattg
attcgctggaacgagacacaaactattatgcatggtgagatcgataagaagtatggagtt
aatcaattacatttggtcatttcgcagcaaggaaaaaaagccaaaattaatgggttggaa
caaaaaaagctcagtcagtttattggaaccttgaatgttgttttgtttgcaccggaggat
ttagaaattgttaaaggctcccctggtacaagacgacgttttttagatatggaattaggc
caagtttatcccaggtatctgcatgacatcatgcaatatcagaaaattctggttcaacgc
aataattatttaaagcagctaatccagcaaaaaaacataaattacgagatgttagaagtg
tggaatgagcaattagtaaattttggtgttaaaatagttaaaaaaaggcaaagctttata
aaaaagctgcaaatatgggcagaacgagtccattctggaataaccaatcaacgtgagcta
atgactatagagtatctaccatcctttgatttacaggggtctgaagatgaaactgttata
tttgaacagtttatggtaaagttaaaacatgtgaaggaacaggaaattagacgtggtgtg
acgcttgtaggacctcatcgcgacgacatgcttttttttattaacggcaaagaagtccag
cagtatggatctcaaggacaacaaagaacaacggctttatccttaaaattagcagaactt
gaattaattcatgaagaagtaggggaatatcctattcttcttttggacgatgttttatct
gaattggatcagtatcgtcaaacgcagcttatcgaaaccttccagaacaaagtgcaaacc
tttattacaacaacaagtatcgagagcataaatttaagtaaattaagtgatgcagcgata
tttaaagtgagaaatggtagcatagaaaggtag

DBGET integrated database retrieval system