KEGG   Paenibacillus psychroresistens: EHS13_00030
Entry
EHS13_00030       CDS       T06328                                 

Gene name
gyrB
Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing) subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_00030 (gyrB)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00030 (gyrB)
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     EHS13_00030 (gyrB)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_00030 (gyrB)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      EHS13_00030 (gyrB)
SSDB
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Other DBs
NCBI-ProteinID: QGQ93433
UniProt: A0A6B8RCV9
LinkDB
Position
4280..6196
AA seq 638 aa
MSANANTYDENQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVWEVVDNSIDEALAGYCNK
IDIVVHKDNSVSVTDNGRGIPVGEHAKMKRPALEVVLTVLHAGGKFGGDDSGYKVSGGLH
GVGVSVVNALSSLLVVTVKVKGHVYQQEYSKGVPQYDLKVIGDSDETGTKITFTPDPTIF
TETTEYDFDILQSRLRELAFLNKGIEINLLDERTDHSASYSYEGGIVSFVEYLNRNREVL
HEKPIFTEGTRDNIQVEVALQYNDSYSENIYSFANNINTHEGGTHESGFKSALTRILNDY
ARKTNAIKESDSNFSGDDVREGLTAIISVKIPEPQFEGQTKTKLGNSEVRGIVESLFSEK
LQEFMNENPAVAKKIIEKGIMASRAREAARKARELTRRKSALEIGSLPGKLADCSSKDAS
ISEIYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKSRLDKILGNTEIRSMITAFGT
GISDDFDIAKARYHKIIIMTDADVDGAHIRTLLLTFFYRYMRKLFEMGYIYIAQPPLYKL
ERNKTIRYAYNDKQREAILQEYGEGVKVNTQRYKGLGEMDAIQLWETTMDPESRILLQVS
IQDAIEADEIFDTLMGDNVEPRREFIEMHAKYVKNLDI
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgtcagccaatgccaatacgtatgatgaaaatcagattcaagtactcgaaggattagaa
gctgtaagaaagcgtccagggatgtatattggttcaacaagtgctagagggttgcatcat
ttagtttgggaagttgtagataatagtatcgatgaggcacttgccggctattgcaacaaa
atagatatcgttgtacataaagacaatagcgtgagtgtcacggataatggacgaggtatt
cccgtaggtgagcatgccaaaatgaaaagaccggcacttgaggttgttttaaccgttctt
catgcaggcggtaaatttggtggcgatgattcaggttataaagtatcgggagggctacat
ggtgtaggggtttcagttgttaatgctctctcatctttgttggttgtaaccgtaaaagta
aaaggccatgtgtatcaacaagaatatagcaaaggtgtaccacaatatgatttaaaagtc
attggtgactccgatgaaacaggtactaaaatcacatttacaccagatccgactattttt
acagaaacaacggaatatgattttgatattcttcaatctcgacttagagaattagctttt
ttaaataaaggtattgagattaatctattggacgagcgtacagatcactctgcatcatat
agctatgaaggtggaattgtctcatttgttgagtatttaaatcgtaatcgtgaagtattg
catgaaaaaccaatttttactgaaggaactagagataatattcaagtcgaagttgcgttg
caatataacgatagctattcggagaatatctattcgtttgctaataatattaatacgcat
gaaggtggtacgcatgaatctggcttcaaaagcgcattaacgcggattttgaatgattat
gcacgcaaaaccaatgcgatcaaagagagtgattccaacttttctggagatgacgtgcgt
gaaggtttaactgcgatcatttctgtaaagattccagagccacaatttgagggtcaaact
aaaacaaaattgggcaatagtgaagttagaggaattgttgaatctttattctctgaaaag
ctgcaagagtttatgaatgaaaacccggctgtagccaagaagataattgaaaaagggatc
atggcttcacgtgctagagaagctgctcgtaaagctcgtgagttaacacgtcgtaaaagt
gcactcgaaatcggatcattacccgggaaattagcagattgctcctctaaagatgcttca
attagtgaaatttatatagtcgaaggtgattctgcgggtggttctgctaaacaaggacgt
gaccgtcatttccaagctattttacctttgcgcggaaaaattctaaacgtagaaaaatct
agattagacaaaattcttgggaatactgaaattcgttctatgattacagcattcggtact
gggattagtgatgattttgatattgccaaagctcgttatcacaaaattattattatgacg
gatgccgatgttgatggtgctcatattcgtacattgctattgacattcttttatcgctat
atgagaaaactatttgaaatgggctatatttatattgctcaaccaccgttatataagcta
gaaagaaataaaacgattcgttacgcctataatgataaacaaagagaagctattcttcag
gaatatggtgaaggcgtcaaggtgaatacacagcgatataaaggtctaggtgaaatggat
gctattcagctatgggaaactacgatggatccagaaagccgaatattgctacaggttagt
attcaagatgctatcgaagcagacgaaattttcgatacgctaatgggtgataacgttgag
cctcgtcgcgaatttattgagatgcatgccaaatatgtgaaaaatctagatatttaa

DBGET integrated database retrieval system