KEGG   Paenibacillus psychroresistens: EHS13_00035
Entry
EHS13_00035       CDS       T06328                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_00035 (gyrA)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00035 (gyrA)
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     EHS13_00035 (gyrA)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_00035 (gyrA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      EHS13_00035 (gyrA)
SSDB
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C NTase_sub_bind
Other DBs
NCBI-ProteinID: QGQ93434
UniProt: A0A6B8RC02
LinkDB
Position
6223..8688
AA seq 821 aa
MAEELVSQVKDRDIGSEMRESFMDYAMSIIVSRALPDVRDGLKPVHRRILFAMSELGMSS
DKPHKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFSLRYMLVDGHGNFGSIDGDMAAA
MRYTEARLSKIAMEMLRDLNKETVDFQPNYDGEENEPVVLPSRFPNLLVNGVSGIAVGMA
TNIPPHNLGEVIDGLQEMIKFPDITPMELMEFIKGPDFPTYGFILGREGIKRAYNTGRGS
VTMRARAIIEENSGKARIIVNELPYQVNKSRLIINIAELVREKKIDGITDLRDESDRNGM
RIVIELRRDVNPSVVLNNLYKQTSLQSNFGINMLAIVNKEPKTLNLKDILYHYLEHQKVV
IRRRTEFELRKAEARAHILEGLRIALDHLDRVIALIRASQNAEEAREGLISQFSLSYDQA
QAILDMRLQRLTGLEREKIEAEYAELVKRIAEYKAILGDEQLVLSIISEELSEIRNKFAD
KRRSEITIGEESIEDEDLIPREEVIITITHTGYIKRLPVNTYRNQKRGGRGVIGMDTKDH
DFVEHLFVTNTHHFLLFFTNKGKVYKLKAYEIPDLSRTARGTPIINLIQIEQGETINAVI
PVESFDSEQFLFFATKKGVIKKTPLNEYGNIRKGGLIAINLREDDDLIGVKLTDGDRAIV
MGTKLGMSIHFPEKDVRSMGRSATGVIGIRISEQDDVIDMDIVSEDDSVLIVTTKGFGKR
TPMSEYRIQTRGGKGIKTLNVTPKNGPVVGLKVVKDDEDLMIITALGTVIRTDMSGISSM
GRNTQGVRLINIKEDDEVATLARVEKSEEIAEFADDDELIE
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggctgaagagctcgtttcccaagttaaagatagagatattggttcagaaatgcgcgaa
tctttcatggattatgcaatgagcattattgttagtcgggcattaccggatgtaagagac
ggtttgaaacctgttcatcgtcgtattttattcgcaatgtctgaattaggaatgagctcc
gataaaccacataaaaaatcagcgagaatcgttggtgaagtaattggtaagtatcaccca
catggtgatagcgccgtttatgaatccatggttagaatggcgcaggatttctcattgcgt
tatatgctagttgacggtcatggtaactttggatcgattgatggagatatggctgcagca
atgcgttatacagaagcacgtctttccaagattgctatggaaatgttgcgtgatcttaat
aaagagaccgttgactttcaaccaaactatgacggtgaagagaatgaaccggttgtactt
ccttcgcggttccctaatttattagtaaatggtgtttctggcatcgccgtaggaatggca
acgaatattccgccacataatttaggcgaagtaattgatggacttcaggaaatgattaaa
tttccagatataactccgatggagttaatggaatttattaaagggcctgattttcctacg
tatggtttcattttaggacgtgaaggaattaagcgagcatataatacgggccgtggttcg
gttacaatgcgagctagagcaattattgaagaaaacagtggtaaggcgagaattattgtc
aatgaattgccatatcaggttaataaatcgcgattgattattaatattgcggaattggtt
agagagaaaaaaattgatggcataacagatctacgggatgagtcggatagaaatgggatg
cgaattgttattgagctgcgtcgagatgttaatccgagtgtagttttgaataatctttat
aagcaaacatccttgcaaagtaattttggaatcaatatgttagctattgttaacaaagaa
ccaaaaactttgaatcttaaagatattttatatcactatctggagcatcaaaaagtagtt
attcgtcgccgtacggaatttgaattgcgtaaagctgaagctagagcacatattcttgaa
ggtttacggattgctttggatcatctagatcgggtaattgccttgattagagcatcacag
aatgccgaagaagcaagagaaggattaatttcacaatttagtttaagctatgatcaagct
caagccattctcgatatgcgtttacagcgtttaacgggtttggagcgagaaaaaattgaa
gcagaatatgctgaactggtcaaaagaatagccgaatataaagctatcttgggagatgag
cagctggttctttccatcattagtgaagaactgagtgaaattagaaataaatttgctgat
aaaagacggtctgaaattacgattggtgaagagagcattgaggatgaagacttaattcca
cgtgaggaagttattattacgattactcacacgggttatatcaaacgtcttccagtcaat
acttatcgaaaccaaaaacgtggtggacgtggagtaattggaatggatacgaaggatcat
gatttcgttgagcatctatttgttaccaatacccatcattttctactgttcttcacaaat
aaaggaaaagtatataaattaaaagcttatgaaattcctgatttaagcaggactgctaga
ggaacaccgattatcaatttgattcaaattgagcaaggtgagacgattaatgccgtaatt
ccggtagaaagttttgattcggagcaattcctattctttgcaacaaaaaaaggggttatt
aagaaaacacctttgaatgaatatggtaatatccgtaagggtgggctgatcgcgattaat
ctgcgtgaagacgatgatttgatcggtgtgaagctaacagatggagaccgagctattgta
atgggaactaagctaggaatgtccattcactttccagagaaagatgtccgctccatgggt
cgatcagcaacgggtgttattggtatacggatttccgagcaagatgatgttatagatatg
gatattgttagtgaagacgacagtgtacttattgtaacaactaaaggctttggtaaacga
acgccaatgtctgagtatcgtattcaaacacgtgggggtaaaggaatcaagactttgaat
gtaacccctaagaacggacctgtggttggtttaaaagtggttaaggatgatgaggatcta
atgatcataacggcattgggtacggttatccgaactgatatgtcaggtatttcctctatg
ggtagaaatacccaaggtgttcgtttgatcaatattaaagaagatgatgaagtagcaacc
ttggcacgagtagaaaaaagcgaggaaattgctgaatttgctgatgatgacgagctaata
gaataa

DBGET integrated database retrieval system