KEGG   Paenibacillus psychroresistens: EHS13_00755
Entry
EHS13_00755       CDS       T06328                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC subunit UvrB
  KO
K03702  excinuclease ABC subunit B
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_00755 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00755 (uvrB)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_00755 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EHS13_00755 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR AAA_30 DEAD UvrD-helicase AAA_19 SWI2_SNF2 AAA_7 Kinesin AAA DUF87 AAA_22 Microtub_bd AAA_16 AAA_5
Other DBs
NCBI-ProteinID: QGQ99906
UniProt: A0A6B8RXP8
LinkDB
Position
161887..163881
AA seq 664 aa
MNDIVRSDKKFELVSEFSPQGDQPRAIEQLLKSITAGQKQQTLLGATGTGKTFTMAKVIA
ELNRPTLVIAHNKTLAAQLCSEFKQFFPNNAVEYFVSYYDYYQPEAYIPSSDTFIEKDSS
INEEIDKLRHSATSSLFERRDVIIVASVSCIYGLGSPIEYGNLLLSLRVGMERSRNEILH
KLVDIQYQRNDLNFVRGTFRVRGDVVEIFPASHSEQAVRIELFGDEIEKIVEINVLTGEI
IAERDHIAIFPASHFVTHEDTMKVAIVHIERELEERLAVFREEGKLLEAQRLEQRTRYDI
EMMQEMGFCSGIENYSGPLTFREKGATPYTLLDYFPDDMLFVVDESHVTLPQIRGMYNGD
RARKEMLVNHGFRLPSAMDNRPLRIEEFEDKVSQIVYVSATPGPIELERCPIMVEQIIRP
TGLLDPIIEIRPSKGQIDDLIGEIHERIRRDERVLVTTLTKKMSEDLTDYLKNIDIKVRY
LHSDIKTLERLQILRDLRLGVFHVLIGINLLREGLDLPEVSLVCILDADKEGFLRSERAL
IQTVGRAARNSDGRVIMYADKITDSMRKALDETERRRVIQAAHNEANGITPTTISKKVRD
VIEASKVAEQKADYLTGVGGKLNKKERIALIERLEQEMKTAAKNLQFERAAELRDAVLEL
KAED
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaacgatatagtacggagtgataaaaagtttgaattggtttcagagttttcaccgcaa
ggggaccagccaagagcaattgagcagctgcttaaaagcatcaccgctggacaaaagcag
caaactctcttaggcgcaacaggtacagggaaaacctttacaatggctaaggttatagcc
gaattgaatcgccctactcttgtaattgcccataacaaaacgttagcggcccagctttgc
agcgaatttaagcagtttttcccgaataacgcagtcgagtattttgtcagctactacgat
tactatcagccggaagcctatattccctcttcggatacttttatcgagaaggattccagc
atcaatgaagaaatcgataagctgcgacattcagcaacaagctctttatttgaacggcga
gatgtcattatcgttgccagtgtttcatgcatttacggtttaggatctcccatagaatat
ggaaatctattgttatctcttcgtgtgggtatggaacgttcgcggaatgaaatcctccat
aaattagttgatattcagtatcagcggaatgatttgaattttgtgcgcggtacttttcgt
gtgcgaggcgatgtagtagagattttcccggcttcacacagtgagcaagctgttaggatc
gagttatttggcgacgagattgagaaaattgtcgaaatcaatgttttaacaggtgaaatt
attgctgaacgggaccacattgctatttttccagcctcacattttgtgacgcatgaagac
acaatgaaggttgccatagtccatattgagcgcgagcttgaggaacgcttagctgtattc
cgtgaagaaggcaagctgcttgaagcacagcggttggagcagcggacgcgttatgatata
gaaatgatgcaagaaatgggtttttgttcagggattgagaactattctggacctttaacc
ttccgtgaaaaaggagctaccccttatacgcttttggattattttccagatgatatgttg
tttgttgtggatgaatctcatgtaaccttaccgcaaattcgtgggatgtacaacggggat
agagcgagaaaagaaatgctcgttaatcatggattccgactaccttccgctatggataat
cgccctctgcgcatcgaagaatttgaggataaagtcagtcaaatcgtctatgtttctgca
acacctggtcccattgaattggaacgctgtcctattatggttgagcagattattcgtcca
acaggcttgcttgatcccatcatagaaattcgtccttcgaaaggtcaaattgatgattta
ataggtgagattcacgaacggattcgcagagatgaacgtgtactggttacaacattgacc
aagaaaatgtcagaagatttaactgactatctcaaaaacatagatattaaagtgcgatat
ctgcattcggatattaaaaccttagaacgcttgcaaattttgcgtgatttacggctaggt
gtttttcatgttttaattggtataaatctgcttcgtgaaggcttggatttacctgaagta
tccttggtttgtattttggatgcggataaagaaggattcttaagatcagaacgcgcatta
attcaaacggtaggccgagctgcccgaaactcagacggccgagtcattatgtatgccgat
aaaataacagactccatgcgtaaagctttagatgaaacggagcgtagacgagtcattcaa
gctgcacataacgaagcgaatggcattacgccaacgacgatcagcaaaaaagtacgtgat
gtgattgaagctagcaaagtagccgagcaaaaagcagattatctaacaggtgtgggcggc
aagctcaacaaaaaagagcgcattgcactcatcgaacgtttagagcaagaaatgaaaacc
gcagctaagaatcttcaattcgaacgcgccgccgaactccgcgatgcggtcttagaactt
aaagcagaagattaa

DBGET integrated database retrieval system