KEGG   Paenibacillus psychroresistens: EHS13_00760
Entry
EHS13_00760       CDS       T06328                                 

Gene name
uvrA
Definition
(GenBank) excinuclease ABC subunit UvrA
  KO
K03701  excinuclease ABC subunit A
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_00760 (uvrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00760 (uvrA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_00760 (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EHS13_00760 (uvrA)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_21 AAA_16 AAA_29 RsgA_GTPase AAA_22 BCA_ABC_TP_C AAA_18 AAA_23 AAA_25 DnaJ_CXXCXGXG AAA_24 cobW NACHT MMR_HSR1 Viral_helicase1
Other DBs
NCBI-ProteinID: QGQ93556
UniProt: A0A6B8RDV1
LinkDB
Position
164155..167007
AA seq 950 aa
MASEHIVIKGARAHNLKNIDVTIPRDRFVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMEKPDVDSIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARVGQP
HCPTHGIAITAQTVEQMVDRIMEYPEKTRIQILAPLISGRKGEHTKLLGDIQRQGFVRVR
VNGEIIDLSEKIELDKNKKHKIEVVIDRIVVKEDVQVRLADSIETALKISEGRVLIDVAD
HDELLFSQNLACPECGFSIEDLAPRMFSFNSPYGACPDCDGLGSKMIVDPDLLVSDRKKT
IQDGAFEAWAGSTSNYYPQFLASVCLHYKIPRNVAIEKLTEDQMKVLLYGTDGEKIRFRY
ENELGQTRDAMVPFEGIIKNLERRYRDTFSDGIREHIEAYMSSKACGKCKGQRLKAESLA
VTIQGKNIAYSTGLSIGDAQKFFSNLVLTDREMQIATLILKEINARLGFLVNVGLDYLAL
SRAAGTLSGGEAQRIRLATQIGSSLMGVLYILDEPSIGLHQKDNARLIETLLHMRDLGNT
LIVVEHDEDTMLAADYIIDIGPGAGIHGGQIISQGTPEQVMADPNSLTGEYLSGRKFIPI
PLKRRATNGKWLEIKGAKENNLRNVNVKFPLGVFACVTGVSGSGKSTLINEILYKTLARE
LNGAKVRSGEFKEILGLEHIEKVIDIDQSPIGRTPRSNPATYTGVFDDIRDLFSVTSEAK
IRGYKKGRFSFNVKGGRCEACRGDGIIKIEMHFLPDVYVPCEICKGKRYNRETLEVKYKG
KNISEILGMTIEDACEFFKNVPRISRKMQTLFDVGLGYMDLGQPATTLSGGEAQRVKLAA
ELYRRSTGKSIYILDEPTTGLHIHDIARLLEVLHRLVDNGESVLVIEHNLDVIKTADYVI
DLGPEGGSRGGLIVASGTPEEVVKVKGSYTGQYLKPVLERDRARTLAEVH
NT seq 2853 nt   +upstreamnt  +downstreamnt
gtggcaagtgaacatatcgtcattaaaggagcaagagctcacaatctcaaaaacatcgat
gtgaccattccacgtgatcgttttgtcgtattgacaggattaagcggttcaggtaaatca
tccttagcgttcgacacgatttatgcagaagggcaaagaagatacgtagagtcgctttct
gcttacgcccgtcaatttttaggccagatggagaagccggatgtagattctatcgaaggt
ttatctccggctatatctatcgaccagaaaacaacaagccgtaatccccgctcaaccgtc
ggtacggttacagaaatctatgattatctgcgtttgctttttgcgcgtgtcggtcagccg
cattgtccgactcatgggatagcaataactgcacaaaccgttgaacaaatggtggaccgc
attatggagtacccagaaaaaacaagaattcaaattttggctccactgatctcaggtcgc
aaaggggagcacactaagcttttgggcgatattcagcgacaaggctttgttcgagtacgg
gtgaatggcgagattatcgacttgtcagaaaaaatagaattagataagaacaaaaagcat
aaaatcgaagttgttatcgatcggattgtggttaaagaagacgtacaagtcagattagcc
gactcgatagaaactgcgctgaagatctctgagggcagagtacttatagatgtggcagat
catgatgagctgctgtttagtcagaatctagcatgccctgaatgtggcttcagtattgag
gaccttgctccacggatgttttctttcaatagcccttatggtgcttgtccagattgtgac
gggttaggcagtaaaatgattgtagatcccgatctcctggtttccgatcgcaagaagacc
attcaggatggagctttcgaagcatgggcgggtagtacatctaactattatccacaattt
cttgcttccgtttgtctgcattataaaattccacggaacgtggctatagagaagctaaca
gaagatcaaatgaaagttttgttatacggcacagatggggaaaagattcgttttcgatat
gagaatgaacttggacaaacaagagatgccatggttccatttgaagggatcattaagaat
ttggaacgtaggtatcgtgataccttttcagatgggatacgggagcatatcgaggcttat
atgagctctaaggcttgcggtaaatgtaaagggcagcgtcttaaagccgagagcttggct
gtaacgattcaagggaagaatatagcttactccacaggtctgtctattggagatgcacag
aagtttttctcgaatcttgtactgacagatcgtgaaatgcagattgccacactaattctt
aaagagattaatgcacgattgggtttcttagttaatgtgggcttggattacttagcgcta
agtcgagcagcaggcacattatcgggtggggaagcacagcgtattcgcttagcaactcaa
attggttcaagcttaatgggcgtgctatatattctagatgagccgagtattggattgcat
cagaaggataacgctcgtttaatcgagactctactgcacatgcgtgatctaggcaatacc
ctaatcgttgttgagcatgatgaagacactatgttggctgcagattatataatcgatatt
ggtcctggagcaggtatccatgggggccaaattatttcacaaggaacacctgagcaagtt
atggcagatcctaactctttaaccggagaatatttaagtgggcgtaagttcattcccatc
ccattaaaacgtcgtgctactaacggtaaatggctagaaataaaaggtgcaaaagagaac
aacctgcgtaatgtaaatgtgaaattcccgttaggggtttttgcttgtgtaactggggta
tcaggctctggaaaaagtacattgatcaatgagattctgtataagaccttagcgcgtgaa
ctgaatggggcaaaagtcagatcaggtgaatttaaagaaattctcggacttgaacatatt
gagaaagtaatcgatattgatcaatctccaattggacgaaccccacgttctaacccggct
acctatacaggtgttttcgatgatattcgggacttattctccgttacatcggaagcaaaa
atccgcggctacaagaagggtcgttttagcttcaatgtaaaaggcggccgttgtgaagcc
tgtcgaggggatggcatcatcaaaattgaaatgcattttctacccgatgtttatgtacca
tgcgaaatttgcaaaggcaaacgctacaaccgcgaaacacttgaggtcaaatataaaggc
aagaatatatcggagattctaggcatgacgattgaagatgcttgtgaattctttaagaat
gttccgcgcattagccgcaagatgcagaccttattcgatgttggtctcggttatatggat
ttgggtcagcctgcaaccactttatcaggtggagaagcacaacgagttaagcttgcagct
gagttataccgtcgcagtacaggcaagtcgatctatatactagatgagcctactactggc
ttgcatatccatgatattgctcgcttgttagaggtcctgcatcgtttagtggataacgga
gaatccgtgttagtcattgagcataatctagatgtaatcaaaacagctgattatgtgatt
gatttaggacctgaaggtgggagtcgtggtggcttgattgttgcttcaggaacaccagaa
gaagtcgttaaagtaaaaggttcttatacagggcaatacctaaaacctgtgctggaacgg
gatcgcgcacgtaccttagcagaagtacattaa

DBGET integrated database retrieval system