KEGG   Paenibacillus psychroresistens: EHS13_00930
Entry
EHS13_00930       CDS       T06328                                 

Gene name
pcrA
Definition
(GenBank) DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_00930 (pcrA)
   03430 Mismatch repair
    EHS13_00930 (pcrA)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_00930 (pcrA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_00930 (pcrA)
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_00930 (pcrA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Exonuc_V_gamma AAA_11 ResIII
Other DBs
NCBI-ProteinID: QGQ93583
UniProt: A0A6B8RDF6
LinkDB
Position
199682..201988
AA seq 768 aa
MMNAQIDIYESISKLNPEQKKAVEAVSGPLLIMAGAGSGKTRVLTHRIAYLVASGKAAPW
SILAITFTNKAAREMQDRVGQLVGNSARDIWVSTFHSMCVRILRRDISRIGFTNNFTILD
STDQLSVIRACMKELNIDTKKFEPKAIQAAMGGAKNELISPEQFANKIGDYMQDITAKVY
KLYQKKLKSNNSLDFDDLIMMTIQLFNEEPEVLQHYQNKFLYIHVDEYQDTNRAQYMLCK
MIAERHHRICVVGDGDQSIYGWRGADITNILNFEQDYPEATTILLEQNYRSTSNILNAAN
KVIANNTGRKPKNLWTSKDEGAKIQLYQADTEHEEGYFITSEIKKSIANGKKYLDHAILY
RANAQSRVIEEILIKSEIPYKIFGGIKFYDRKEIKDILGYLRLISNPNDDISLVRIINVP
KRAIGDTTVDKLIALSLQKDQSIFETLLDHLDELEVSPRTKKALSDFCDLISNLYRMVEY
ISVTELAEQLLEQTQYRAELIREGSLESKSRLENIEEFLSVTQEFEKRNEDEDRSLLAFL
TDLALIADIDLMGKDPEVAVDNNSVVLMTMHSAKGLEFPVVFIAGMEEGIFPHSRTLADP
EEMEEERRLAYVGITRAEEQLFLTCSRMRTLFGKTNSNMPSRFLKEIPDEVKESPSRGKE
SYGGGGAGASYRLGQARTFGQNATGSTFGQSSTSINTNRPVTSTPMVAATVNGVTDFRNG
DKVVHNKWGTGTIVAVKGTGEDMELNIAFPAPVGVKRLLAKFAPITKA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgatgaatgcgcaaattgatatatacgagtcgatatccaaattaaatccggaacagaaa
aaagcggtagaggcggtaagtgggccgctattaatcatggctggagcaggcagtggcaag
acacgggtactgacccaccggattgcttatttagttgcttctggcaaggcggcgccttgg
agtattctcgccattacctttactaataaagcagcacgtgaaatgcaggatcgggttgga
cagctagttgggaattcagcaagagatatctgggtttccaccttccactccatgtgtgtg
cgtattctgcgccgagatatttcgcgtattggatttacgaataatttcacgatactggat
tccacggatcagctttcggttattcgcgcttgcatgaaagaattgaacatcgacacgaag
aagtttgaacccaaagccatccaagccgccatgggcggagccaagaatgagctaatctca
cccgagcagtttgccaataaaatcggtgattatatgcaggacattaccgccaaagtatac
aaactctatcaaaaaaagcttaaaagcaacaattcgctagatttcgatgatttaattatg
atgacgattcaattgtttaacgaggaacccgaagtgctccagcactatcagaataagttt
ctttacatccacgtggatgagtatcaggatacgaatcgggcccaatatatgctgtgcaaa
atgatcgcagagcgccatcatcgtatttgtgtggtaggtgacggagatcagtcgatttac
ggctggcgtggagcggatatcacgaatatcttgaattttgagcaggattatccggaagcc
acaacgatactattagagcaaaactaccgatctacctcgaatatattgaatgcagcgaac
aaagtcatagctaacaatacaggccgtaaaccgaagaatctctggaccagcaaggacgaa
ggcgccaaaatccagctctaccaagcagataccgagcatgaagaagggtactttattacc
tcagagattaagaagagcatagccaatggtaaaaaatatctggatcacgctatcctatat
cgcgccaatgcacagtctcgggttatagaggaaattctgatcaagtcggagattccttat
aagatttttggcggcattaagttctacgaccgtaaagaaatcaaggacattctcggctat
ttacgtttaatttccaatccgaatgatgatattagtttagtgcggattattaatgtgccg
aagcgggcgattggcgatacaaccgtggataagcttatcgcattgtcgcttcagaaggac
caatctatttttgaaacgctgttggatcatttggatgagcttgaggttagtccacgtacg
aagaaggctttaagtgatttttgtgatttaatcagcaatttatatcgtatggtggagtat
ataagcgtaacagagctagccgagcagctgctggagcaaactcagtatcgtgctgaatta
atccgcgaaggctcgttagaatccaaatcgcgcttagagaatatagaagaatttctctcg
gttacccaagaatttgagaaacgaaatgaagatgaagaccgctccttgctggctttttta
acagatctagctttaattgcagacattgatttgatgggcaaggatcccgaggtagccgtt
gacaacaattcagttgtattaatgacaatgcatagcgctaagggattggagtttccggtt
gtattcattgcagggatggaagaaggcatatttcctcacagccgaacactggcagaccct
gaagaaatggaagaggaacgtcggctagcttatgttggcatcactcgagcagaggaacaa
ttgtttctaacttgctcacggatgcgaactttgtttggtaaaaccaacagcaatatgcct
tctcgctttttgaaggaaatccctgatgaagtgaaagagtcgccttcacggggtaaagaa
agctatggcggaggaggagcgggcgcttcttatcgattgggacaagcgcgtacttttggg
caaaatgcaacgggaagcactttcggacagtcgtcgacaagtattaatacgaataggccg
gtaacttcaactccgatggtagctgcgactgtaaatggagtgaccgatttcaggaatggc
gacaaagttgttcataacaagtgggggacaggcactattgtagctgttaaaggcacgggt
gaggatatggagctcaatattgcttttccggcacctgtaggagtaaaaaggctgttggcc
aaatttgcacccataaccaaggcttga

KEGG   Paenibacillus psychroresistens: EHS13_03950
Entry
EHS13_03950       CDS       T06328                                 

Definition
(GenBank) DNA helicase UvrD
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_03950
   03430 Mismatch repair
    EHS13_03950
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_03950
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_03950
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_03950
SSDB
Motif
Pfam: UvrD_C AAA_19 UvrD-helicase UvrD_C_2 Viral_helicase1 DUF2075 PhoH AAA_30 NACHT T2SSE AAA_16 ResIII DEAD DUF1726
Other DBs
NCBI-ProteinID: QGQ94118
UniProt: A0A6B8RFB8
LinkDB
Position
832033..834186
AA seq 717 aa
MLDQTQSAYQDELKQLKKTTDEIDKQLQKIVETPRYFGQDLTEQVLDLNREVKREHLQKA
SAEPYFGRLDYQEIGKTQPFPLYIGKNGVENDKTHELLVIDWRAPVASLFYSFTGGTEEA
TYESPEDGTISGHVLLKRNLVIRQQVLQRVVDTYDRDSDEPTITDEFLLYRLGENKDNRL
RDIVSTIQAEQDQIIRSVRNTAIVIQGVAGSGKTTVALHRLAFLLYQYRDNIRAERMIIF
APNSMFLDYISGVLPELGVGHIQQTIFQDWTLALLDNAVKLTDSTKRLAYWFNIGAKKPQ
IDNQAPGRFKGSIAFLHYIDEKLQQFEAACLPTADLVAWEGKTLLNKTVHEWFYVENKHY
PLMKRRDRTVARMKRWIEIELTKFPSESMRKEYKKKANDRLRAYLKQWPEESPFSFYKTI
FTEPHVPDELIKESNLLFKKKEVQPEDLAPLIYIHNRFYGIESEQMFDHVVIDEAQDFSP
FQVALLKEQTRGGSFTILGDLSQGIHAYQGIWNWDEISSLFEADRTMYHQLDRSYRSTME
IIHFANAVLSRGGEAITPAIPVFRSGEKVRLIELGNEQQKVEALLKAVGKLQESGLINTI
AIVDRTERECAILHEALTGKGLAANLIEAGQREYLGGISVLPVYLTKGLEFDAVLIIDAD
PLHYEQNFQDAKLLYVGCTRALHELWLFYVGEASPLFANLLYNEEINNGFAIEERWL
NT seq 2154 nt   +upstreamnt  +downstreamnt
atcttggaccagactcaaagtgcctatcaagacgagcttaaacagctcaagaaaacaacc
gatgaaatcgacaagcagctgcagaagattgtggaaacgccacgctacttcgggcaggat
ttaacggaacaggttttggatttaaatcgtgaggtcaagcgggagcatctgcaaaaagct
agtgcggagccatattttggacgtttggattatcaggaaattggtaaaacccaaccattt
ccgctttatatcggcaagaatggtgtcgagaatgacaaaacccatgaactattagttata
gattggcgtgcacctgtcgccagtcttttttactcttttacaggcggtacagaggaagcg
acttatgaatcaccagaggatggcaccatcagcgggcacgttctgttaaagcgaaattta
gtgattcgccagcaggtgctgcagcgtgtagtggatacctacgatcgagatagcgatgag
ccgacgataacggatgaattcttactctaccgactaggtgagaataaagataatcgcttg
cgagatatcgtttcaaccattcaagccgaacaggatcagattattcgctcggtaagaaat
acggctatcgtgattcaaggggttgctgggagtggaaaaacaacggtagctttgcatcgt
ctggctttcttgctctaccaatatcgcgataatatccgcgcggagcggatgattattttt
gccccgaatagcatgtttctcgattacatctcaggtgttctgccagagcttggtgtaggt
catattcaacaaacgatttttcaggattggactttggcattattagataatgcagtgaag
ctgactgattcgactaaacgcttagcttattggtttaatattggagcaaaaaaaccgcaa
attgataatcaagctccgggtcgttttaaaggctcgattgctttccttcattatatagat
gaaaaattacaacagtttgaagccgcttgcctacctacagcagatctagttgcttgggaa
gggaaaaccttgctcaataagacggttcatgaatggttttatgtcgagaacaagcattat
ccactaatgaaacgtcgtgatcgtactgtggcgcggatgaagcgctggatagaaattgag
ttaactaaatttcctagtgagtcgatgcgcaaagaatacaagaagaaagccaatgaccgc
ttgcgtgcctacttgaagcaatggccagaggaatccccgttttctttttacaaaactatt
ttcacagaacctcatgtaccagatgagttaattaaagaatctaacctgcttttcaagaaa
aaagaggttcaaccagaggatttagcaccgctcatttatatccacaatcggttttatgga
attgaaagcgagcaaatgtttgatcatgtagtgatagatgaagcccaggatttctcgccg
tttcaggtagctttacttaaggagcagacccgcggaggttcttttacgatactaggtgat
ttgtcgcaagggattcatgcttaccaggggatctggaattgggatgagatttcctcacta
tttgaggcagaccgcacgatgtatcatcaattggaccgcagctatcgttcgaccatggaa
attattcattttgccaatgccgtattgagtcgtggtggtgaagctattacaccagctatc
cctgtgttccgcagtggggaaaaggtacgtttgatcgaattgggcaatgagcagcaaaag
gtggaggctttattgaaggcagtaggcaagctgcaggaaagtggcttgattaatacgatt
gcaattgttgatcggacggaacgagaatgtgcaattctgcatgaggctttaacaggaaaa
ggcttggcagccaacttaattgaagcgggacaacgggaatatctcggtggaatctcggtg
cttccagtctatttaaccaaaggcttggaatttgatgctgtattgattattgatgcggat
ccgctccattatgaacagaatttccaggatgcgaagctgctttatgtcggttgtacgcgg
gcattgcacgagctgtggttattttatgtaggagaagcttcccctttattcgccaatcta
ttatataatgaagaaattaataatgggtttgctatagaggagagatggctttga

KEGG   Paenibacillus psychroresistens: EHS13_17990
Entry
EHS13_17990       CDS       T06328                                 

Definition
(GenBank) helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_17990
   03430 Mismatch repair
    EHS13_17990
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_17990
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_17990
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_17990
SSDB
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 Viral_helicase1 AAA_22 AAA_16 DUF2075 DEAD AAA_14 AAA_30 NACHT ResIII
Other DBs
NCBI-ProteinID: QGQ96631
UniProt: A0A6B8RJK9
LinkDB
Position
complement(3980356..3982737)
AA seq 793 aa
MSLTESDWQFEQQRMEHVNDQLNQRMEQLAQEVGLVKGDIGDIRKNFWDGITINLGNPDD
MGETFFSIKQQADVISERERMHKLAVVTLDKLNRLLHSPYFGRIDFVEQGTTNVESIYLG
IASLLDADGITFLIYDWRAPIASLYYDYPPGLVKYETPDGEVTGEMLMKRQYMIRDGVIE
LMFDTSVTIGDQLLQKVLGHSSEAQMKSIVATIQREQNQIIRNDRSRMLLVQGVAGSGKT
SAALQRVAYLLYKHRQTLKADQMLLFSPNPMFNSYVSTVLPELGEENMQQTTFQQYLEYR
LNEEYQLEDPFEQLETILSAEENTVEYEARLAGIRFKSSIEFYKVILAYKEVLQHQDILF
KPLVFRGRNVVSVKRMKERFYSYDPAIRLANRIELHRDWLLKELSVFEEKEWREAWLDDE
VQNLDFDDLHHSFKKLRLNQKGKGATFDDYDKQYEVLARWVVQEKLNPIRHRIQTLRFVD
VLGLYRQLFRDDNALSISASKHIQLPDNWHDICEQTLLRLEKLQLSYEDATPFLLIKDLV
HGYQSNHSIRYVIIDEVQDYSAFQLEFIKHLFPRSKMTALGDLNQAIYAHASILHESQPV
MEMYGAAQTELIRLVNSYRSTRQIVEFTRGIVQGGDQIMPFNRPGEKPQIIVVDDHEQLH
KRILIDIEAFLARGFASIAIICKTAKESEAAYEAMKEQLPLLLITKNTILFEKGIQVIPA
YLAKGVEFDAVILYNGSKEQYRRENERKLFYTACTRAMHELFIYSLGELSPFLSALNAET
YERKEYVDQNVSR
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgagtttaacggaaagcgattggcagtttgaacaacaacgcatggagcatgttaatgat
caattaaaccaacgtatggaacaattagcacaggaagttgggctggtcaaaggtgacatt
ggggatattcgcaaaaacttttgggacggcattacaataaatttaggcaaccctgatgat
atgggcgaaacattttttagtattaaacaacaggctgatgttatttctgagcgtgaacgg
atgcataagcttgctgttgttactttagataaacttaatcgattgctgcattctccttat
tttggcaggattgattttgtcgaacaaggtacgactaatgtggaatctatttatctggga
attgcttcgcttttggacgcagatggcattacgtttctgatttatgactggcgtgctccc
atagctagcctttattacgattacccgcctgggctagtgaaatatgaaactcccgatggt
gaagtaaccggtgaaatgctgatgaaaaggcaatacatgattcgcgacggagtcattgaa
ttgatgtttgatacgagtgtgacgattggggatcaactgctgcagaaggtattgggccat
tcttcagaagctcaaatgaagagtattgtcgccaccatccagagggaacaaaaccagatc
atccgcaatgatcgtagccgcatgctgctagttcaaggagttgcaggtagtgggaaaact
tctgctgctttgcaaagagtagcgtaccttttatacaaacaccgtcaaaccttaaaagca
gatcagatgctcttgttctcaccaaatccgatgttcaatagctatgtgtctacagtactg
ccagagctcggagaagagaatatgcaacaaacgacctttcaacagtatctggagtaccgt
ttaaatgaggaatatcaattagaggatccgtttgaacaactggaaaccattcttagtgct
gaagaaaatacagtcgagtatgaagccagacttgcaggtattcgctttaaatcttcaatc
gaattctataaggttattctcgcctataaggaagtgctgcagcaccaagatattctattc
aagccgcttgtttttagaggacgcaatgtcgtttccgtaaaacgaatgaaggaacgcttc
tacagctatgatccagcaattcgacttgctaaccgcatcgagctgcatcgggattggttg
cttaaagaattaagtgtatttgaagagaaggagtggcgtgaggcgtggttggacgatgaa
gtgcagaatctggattttgatgatttgcatcattctttcaagaagctgcgtttaaatcaa
aaaggtaaaggcgctacttttgatgattatgacaagcagtatgaggtattggcgcgatgg
gttgtccaagaaaaattaaacccgattcgtcatcgtattcaaactctgcgatttgtcgat
gttttgggactatatcgtcaattatttagggatgataacgccttatccattagcgcctct
aagcatattcagttgcctgataattggcacgacatctgcgaacaaaccttgttaaggctg
gaaaaattacagctttcctacgaggatgctacaccttttttgttaattaaagatttggtt
cacggctatcagtccaaccattctattcgatatgtaatcattgacgaagtgcaggattac
tcggcttttcagcttgagtttattaagcatctgttcccacgcagtaaaatgacggcttta
ggtgacttgaatcaagcgatatatgcgcatgcgtccattcttcatgaatctcagccggtt
atggaaatgtatggtgccgcccaaaccgaattaattcgtttagtgaatagctatcgttcc
actcgtcagatagttgaatttacccgtggcattgtccaaggcggcgatcaaattatgccc
tttaaccgtcctggagagaaaccgcaaatcattgtcgtagatgatcatgaacagcttcac
aaacgcatactcatcgatatagaagcttttcttgccagaggctttgcctccattgcgatc
atttgtaaaacagctaaggaaagtgaagccgcctatgaagcaatgaaggaacaattacct
ttactgctcattaccaagaacaccattttgtttgaaaaaggcattcaagttattcccgca
tatttggccaagggggttgaatttgacgcagttatcctctataacggttccaaagaacaa
tataggcgggagaacgaacgaaagctcttttatacagcttgcacaagagccatgcatgaa
ttgttcatatactcattaggtgagctaagtcctttcctaagcgcattgaatgcagagact
tatgagaggaaggaatacgttgaccagaacgttagtcgttag

KEGG   Paenibacillus psychroresistens: EHS13_31190
Entry
EHS13_31190       CDS       T06328                                 

Definition
(GenBank) ATP-dependent helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_31190
   03430 Mismatch repair
    EHS13_31190
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_31190
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_31190
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_31190
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Rsm22 L31 AAA_30
Other DBs
NCBI-ProteinID: QGQ99025
UniProt: A0A6B8RTX3
LinkDB
Position
complement(6965679..6967889)
AA seq 736 aa
MEASEEFFDRKKQELNVTLNEVQKQAVLHGTGPLLLLASPGSGKTTTIIMRIGYLIEVSG
VDPARIKAVTFSKASALDMKERFSRFFPRLPTIDFSTIHSLAFEVVREYYRSTRTNFKMI
EGSLDVTEESNWNADHQPLHKKFILRRLFSTLAGEPITDDQMEELSTYISYIKNKLIPVE
KWALVKCDVPKAEQILLEYEAFKRSGTSQLLVDFDDMLTIGNEAFEKDAKLLSKYQQKYD
FVLTDESQDTSLVQHAIIEKLVSKHGNLSVVADDDQSIYSWRGAEPAYLLNFKDVYPQAV
TLFMEQNYRSSPDIVNVANQFIKRNKNRYEKNMFTVNAPKEPIQIQSFADYQHQVKYLAE
AIREVGELGEVAVLFRNNSSSITLMNEFERVGIPFYIKDADNRFFSHWVVEDILNFMRMT
FTDKRSDLLEKIHNKLSGYVTKQQIQQLKEIDNNESVFDNLLNHVQLQDYQRKILQECKE
TFQQMKGMPPVEAIRVIRTRLGYEKAIEKLCERFGFRKDYLIGILNTLEEIADTLPTMES
FAKRLKHLEQVMKNAKSSKHQNVVTLSTFHSSKGLEFKRVYMIDLIEGVMPSEDDKKKNA
EGQMPLMEEAVRLFYVGMTRAKIKLELLSYTKKDGEKVEESTFINGVRQIIDPPKLVTAE
KITKKEYHLKNINAITAISEIAEGIWVRHATFGLGMVIKLAGKVLEIKFADVGMKSFSSE
ICIENGLLELAQAKKV
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggaagcaagtgaagaattttttgatcgtaaaaaacaagaattaaacgttactttaaat
gaagtgcagaagcaggcagtgcttcatggcactggaccactgctcctgttagcttctcct
ggatcaggtaaaacgacaacaattattatgcgaattggctatcttatagaggtttcaggt
gttgatccagcaagaattaaggcggtcacgttcagtaaggcatcggctcttgatatgaag
gagcgtttcagtcgtttctttcctagactcccgacaattgatttttcaactattcatagc
ttggcttttgaggtagttcgagagtattatcgcagtactagaacgaatttcaaaatgatc
gagggcagccttgatgtaaccgaagaatccaattggaatgcggatcatcagcccttgcac
aagaaattcattctccggagattgtttagcacgcttgcgggcgagcctattaccgatgat
cagatggaagagctgagtacttacattagctacattaagaataaacttattcccgttgaa
aaatgggctttggttaaatgtgatgtgcctaaagccgagcaaattctactagaatatgaa
gctttcaaacgatcaggtacaagccagctgctagtagattttgatgatatgctgacgatc
ggcaacgaggcttttgagaaggatgccaagctattaagcaaataccagcaaaaatatgac
ttcgtgcttacggatgaaagtcaggatacttccttggtgcagcatgcaattattgaaaag
ctagtgagcaagcatgggaatctcagtgttgtggcagatgatgatcaatcgatttatagc
tggcgtggagcggaaccggcgtatttacttaattttaaagatgtttatccgcaggcagtt
accttattcatggaacagaactatcgatcctccccggatatagttaatgtggcaaatcaa
tttataaagcgcaataagaaccgttatgagaaaaatatgtttacagtgaatgctcctaag
gaacccattcaaattcaaagctttgccgactatcagcatcaggtcaaatatctagcagaa
gcgattcgcgaggtcggggagctgggcgaggtagctgtgctttttcgcaataattcttct
tcgattacattgatgaacgagtttgaacgtgtgggtatccctttctatattaaagatgcg
gacaatcggtttttctctcattgggttgttgaagatatacttaactttatgcggatgact
tttaccgataagcgttccgatctattggagaaaattcacaataaactaagcgggtatgtg
accaagcaacaaattcagcagctcaaggaaattgacaacaatgagtctgttttcgataac
ctgttaaaccacgtacagctgcaggactatcagcgcaagattctccaagagtgcaaagaa
acctttcagcaaatgaaaggcatgcctccggttgaagcgattcgagtgattcgtactaga
ttaggctacgagaaagcgattgaaaaactctgcgagcggtttggctttcgtaaggattat
ttgatcggtatccttaatacactggaagaaattgcggatacactgcctacgatggagtct
tttgccaagcggttgaagcatttagagcaggtgatgaaaaatgcgaaatccagcaagcat
cagaatgtagtgaccttatccacttttcatagctcgaagggattggagtttaagcgtgtc
tatatgattgatttaattgaaggcgtgatgccctcggaggatgataaaaagaaaaatgcc
gaaggtcaaatgccgttgatggaagaagctgttcgcttattctatgtgggaatgacacgg
gcgaagattaagctcgagctgctatcctatacgaaaaaagatggagaaaaggtcgaggaa
tctacttttattaatggagttaggcaaattatcgaccctcctaaactagtaacggctgag
aaaataaccaaaaaggaatatcatcttaaaaatataaatgccattacagcgatttcggag
atagcagaaggcatctgggttcgacacgcgacttttggactgggtatggtgatcaagctt
gcaggtaaagtgcttgaaatcaagtttgcagatgtaggaatgaagtctttttctagtgaa
atctgtattgaaaatggacttctggagcttgctcaagcaaagaaagtttaa

KEGG   Paenibacillus psychroresistens: EHS13_31935
Entry
EHS13_31935       CDS       T06328                                 

Definition
(GenBank) helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_31935
   03430 Mismatch repair
    EHS13_31935
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_31935
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_31935
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_31935
SSDB
Motif
Pfam: AAA_19 UvrD-helicase UvrD_C_2 UvrD_C AAA_22 PhoH DEAD DUF2075 NACHT ResIII AAA_30
Other DBs
NCBI-ProteinID: QGR00342
UniProt: A0A6B8RV68
LinkDB
Position
complement(7120735..7123149)
AA seq 804 aa
MNSNDWQQEQERLDLITEKLKSRIVELEPKVDQLSNQAADIRKRFWEEVTVNTSTHEDFE
ESYFTIKQQSAVLSERERSHQLKLQQWKNMNRLLPSPYFGRIDFEEGGLGVSEQVYIGVS
SFVDVDGMSFLIYDWRTPIASLYYDYSPGAVAYETPGGLITGRMELKRQYQIRDGQLQNL
FDSSLTIGDELLQQVLGKGADAQMKSIVSTIQKEQNAIIRNDKSSMLIVQGAAGSGKTSA
ALQRVAYLLYKNRERLKADQIVLFSPNPLFNSYVSTVLPELGEENMQQTTFQEYLEYWLG
STVSLEDPFDQLEYVLTEEATPRYDSRLNGIQYKSSEAYLQALQSYAMWLGREGIQFKTI
RFRDRDLITIEKMKSQFYSYDPSIRLVNRVGLLQEWLLRELTLLERKEQSAFWVQEELNY
LDNEDYAAAYSMLHKEKGVFDFAEEYAKVQEILNKKRRGDEGDFDFVQQEEDLLTRLIVK
EHFKPLRQSVKRLLFIDMNELYLQLFRDDAAYREMTGVTEVPKLWPQICEQTTEKLSNLE
LFYEDATPYLFLKELIEGVRTNTMVRHIFVDEGQDYSMFQYEFLKKLFPRARMTVLGDFN
QAIFTQATNLHVVDSPLIRLYGEADTSQFFLVRSYRSTREIVEFTKSILPSGETIVPFER
RGSKPLLVRVDSSEKRAERMAADLAALQAEAFASIAVITKTATESRDVYETLAAQGCQEL
KHITKKTPNFAKGILVIPAYLAKGVEFDAVLIYDASSQAYQRESERKLFYTACTRAMHRL
LLYTTGVWTPFIQGLDISLYKEQH
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgaactcaaatgattggcagcaagagcaggagcgacttgatctgattacagaaaagctg
aaatcaagaattgttgagctggagcctaaggtagatcaactgagtaatcaggcggcagac
attcgaaaacggttttgggaagaagttacggtcaatacgagcacgcatgaagattttgaa
gagtcttattttacaatcaaacagcagtccgcggtgttgtccgagcgggaacgcagtcac
caattgaagctgcagcaatggaaaaatatgaaccgtctgctgccatctccctattttggg
cggatcgattttgaagagggtggcctaggcgtaagcgagcaagtttatatcggtgtgtcc
tcctttgttgatgtagatggtatgagcttcctgatctatgactggcgtacacctattgcg
agtttgtattatgattattctccaggggcggtagcctatgaaacgccgggagggcttatc
actggaaggatggagctgaagcggcagtatcagattcgcgacggtcagctccagaatttg
ttcgactcgagcttgacgatcggcgacgaattactgcagcaagtgcttggcaaaggtgcg
gatgcacagatgaagagtatcgtgtcgactatccaaaaggagcagaatgccatcatccgc
aacgacaaaagctcgatgctcattgtgcagggagcggctggaagcgggaagacctctgcg
gcccttcaacgagtggcttacttgctgtacaaaaaccgtgagagactcaaggccgatcaa
atcgtcctattttcgcctaatccgctgtttaacagctatgtatctacagtccttcccgag
cttggtgaggagaatatgcagcagacgaccttccaggaatatcttgaatattggctggga
tctacggtaagtcttgaggatccgttcgatcagctcgaatatgtgctgacagaagaagca
acgccaaggtatgactctagactgaatgggattcaatataagtcatcagaagcttatctt
caagctctccaaagctatgcaatgtggctagggcgggaaggcattcaattcaaaactatc
cggttccgggacagagatttgatcaccatcgagaaaatgaaatcgcagttctatagttat
gacccctcaatccgtctggtcaatcgagtcggtctgctgcaggagtggctgttgcgagaa
ctgaccttgctggagcgcaaggagcagagtgcgttttgggtacaggaggagctcaactat
ctcgacaatgaggattatgccgcagcatatagcatgttgcataaagagaaaggtgtcttt
gactttgctgaagagtatgccaaggttcaggagatactgaacaaaaagcgacggggagac
gagggtgactttgactttgtccagcaggaagaagacctgttgacccgcttgatcgtgaag
gagcattttaaaccgctgagacaaagtgtaaaacgcttgctgtttatagatatgaatgag
ctataccttcaattgttcagagacgatgctgcttatcgggaaatgacgggtgtgaccgaa
gtgcctaagctttggccgcaaatctgcgagcaaaccacggaaaagctgagcaatcttgag
cttttttatgaggatgcgacaccatacctgttcttaaaagaacttattgaaggcgttcgg
acaaacacgatggttcggcatattttcgtcgatgagggtcaggattactcgatgtttcaa
tatgaatttctcaagaagctatttccccgcgctcgcatgacggtgcttggagatttcaat
caggccatcttcactcaggcaacgaatttgcacgtggtggattcaccactgattcggctt
tatggcgaggcggatacaagtcagttctttcttgtccgcagttatcgttcaacccgcgag
attgtggagttcacgaaatcgatattgccaagtggggagacgattgtaccctttgaaaga
agggggagtaagccgcttctagtaagagtggacagcagcgaaaagcgggcagaacgaatg
gcagcggatctagcggctcttcaggctgaagccttcgcttcaattgctgttattacgaag
acggcgaccgagagcagagatgtctatgagacattggcggctcagggctgccaggagctg
aagcacatcacgaagaagactcccaatttcgctaaaggaattctggtaattcccgcgtat
ctcgctaaaggagttgaattcgacgccgtactgatctacgatgcttcttcacaggcctat
caacgggaaagtgagcgaaagctcttctatacagcatgcacgcgagcgatgcatcggctt
cttctttacacgacgggggtatggacaccctttattcaggggttggatatctctttgtat
aaggaacagcattga

DBGET integrated database retrieval system