KEGG   Paenibacillus psychroresistens: EHS13_00980
Entry
EHS13_00980       CDS       T06328                                 

Gene name
radA
Definition
(GenBank) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00980 (radA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_00980 (radA)
SSDB
Motif
Pfam: AAA_25 ATPase Rubredoxin_2 ChlI Lon_C NTPase_1 DnaB_C AAA_16 AAA_24 KdpD AAA_22 AAA_14 MeaB DUF2075 Rad51 NACHT DAP3 AAA RecA DUF815 Fer4_NifH IstB_IS21 Zeta_toxin AAA_30 KTI12 ATPase_2 ArsA_ATPase AAA_5
Other DBs
NCBI-ProteinID: QGQ93589
UniProt: A0A6B8RAC6
LinkDB
Position
214625..215998
AA seq 457 aa
MAKVKTKFFCQECGFESAKWLGKCTSCQAWNSFVEELETTEVKTQGMNTPFLRSQEKAIS
ILDIESVSDQRIVTNNLELNRVLGGGVVPGSLILVGGDPGIGKSTLLLQTSHELTQKGLK
VLYISGEESAKQTKIRAERLNALSPLLYVLCETNLEFIMEAIEQVQPQFLVIDSIQTVYH
PTIASAPGSVSQVRECTSHFMRIAKVKGIATVLVGHVTKDGAIAGPRMLEHMVDCVLYFE
GERHHTYRLLRAVKNRFGSTNEIGIFEMTEDGLREVNNPSELFLSERPLGVAGSIVVASM
EGTRPVLVELQALVCATNFPSPRRMSTGIEHNRLSLIIAVLEKRIGFFLQNQDAYINLAG
GVKLDEPAVDLAVAVSIASSFRDQPTQPYDVVFGEIGLTGEVRGVSRVDQRVKEAHKLGF
KRVIMPEKSLKGWTPPSGIEVIGVQTVAEALKVAFRE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcaaaggtaaaaacaaagtttttttgtcaggaatgcgggtttgagtccgctaaatgg
ttagggaagtgcacgagctgccaggcttggaatagctttgtcgaagagctggagactaca
gaagtcaagacacagggaatgaatacaccgtttttacgctcccaggaaaaagcgatttcg
attctggatattgaaagtgtcagcgatcaacggattgtaacgaataacttagaattgaat
cgagtgctcggcggaggtgtagtgcctggctcgttgattttagttggtggagatccgggg
attgggaaatcaacgcttttattgcaaacctctcatgagcttacacaaaaagggctaaag
gttttatatatttcgggggaagaatctgccaaacaaacgaaaattcgcgcagagcgatta
aatgcgctctctcctttactttatgtgctttgtgagacgaacctcgagtttataatggaa
gcgatcgaacaagtacagccgcaatttttggtcattgattcaattcaaaccgtgtaccat
ccaaccatcgcttctgcgccaggaagtgtttcacaggtacgtgaatgcacctctcatttt
atgcgtattgctaaggtgaaggggattgccacagtattggtggggcacgttaccaaagat
ggcgctattgctgggccgcgaatgctggagcatatggtggattgtgtgctctattttgaa
ggggaacgccatcatacttatcgcctgttgcgggctgtcaaaaatcgctttggttcgacg
aatgaaattgggatttttgaaatgaccgaggatgggcttagagaagttaataatccatcc
gagctattcctctcagagcgtcctttaggtgtggctggatcaatagttgtagcaagcatg
gaaggtacgagacctgtactggttgaactgcaagcgcttgtctgtgcgaccaactttcca
tcgccgcgaagaatgtcgacgggtattgaacacaatcgattgtcgttaataattgccgtt
ttagaaaaacggattggtttctttctgcaaaatcaggatgcctatatcaatttagctggt
ggagttaagctggatgagcctgctgtagacctcgctgttgccgtcagtattgcctcaagc
tttcgcgaccaacccacacagccctatgatgtggtcttcggtgaaattgggcttacaggc
gaagtgagaggggtatcgcgagtcgatcaaagagtgaaggaagcacacaagctcggattc
aagcgcgtaatcatgccagaaaaaagcttaaagggttggacaccgccgtcaggtatcgaa
gtaatcggagttcagactgtagcagaggcactaaaagtagcatttcgtgaataa

DBGET integrated database retrieval system