KEGG   Paenibacillus psychroresistens: EHS13_01815
Entry
EHS13_01815       CDS       T06328                                 

Definition
(GenBank) DEAD/DEAH box helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_01815
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EHS13_01815
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    EHS13_01815
SSDB
Motif
Pfam: DEAD_assoc DEAD Helicase_C ResIII PhoH AAA_22 AAA_11 DUF384 PP-binding
Other DBs
NCBI-ProteinID: QGQ93731
UniProt: A0A6B8RAH8
LinkDB
Position
354802..359103
AA seq 1433 aa
MRMLHSALQPFHPTVAAWFVQSFNQPTDVQIQAWSSLRQNQHTLIAAPTGSGKTLAALLP
GLNQIMQDKLAGMNQTPGIRLLYITPLKALNNDVHLHVVQFAEQLHELAAATTQDWPGLR
AAVRTGDTPQNVRNAILRKPPDILVITPESLYLMLTSEKAREVLRTVTYVIVDEIHHIAG
DKRGAHLSLTLERLVEWCGCSFLRVGVSATQKPLDQVARFLGGWEEAEARAVHIIESHED
KIFNLTVSVPDPIAVLHDKEAVWAVLMERILKEMTDCRSTIIFVNNRRLCERLTQRLNDY
CGGGFARSHHGSLSREKRLEVEQLLKQGDLKCLIATSSLELGIDVGHIDLVIQIDSPLQA
ASGIQRMGRAGHGVGEVSRGVIIVRQRSSLPEAAVLCRMIRRREIELIRIRRNALDVLAQ
QIVAMTAMDDWHVEGIWRLIQRSDSYHNFPRERMESLLQVLSGFFPFVRPLLLWNRETNV
LSRHSSSRMAAIMGTGTIPQSANFPVFQGESNIQIGDLDEEFVHESRTGEVFQMGAQSWV
IREIKRDRVVVSEAKNRVSEIPFWRNEGLGRSYELGEKMGVLVAEVCDRLAVKDSDIETV
EWLRAEYGLDSLAANGLMDLMSKQQATSAMPTNRKIVIERYVDLTNQTHVILHNYWGRSL
NRSWQIILERLFEQNLPYKPYSVAKDNGIELIFKQWDHAGQYLIWKIAADSVEKLLLEAI
GKLPMFAITFRRIADVALLLSRQFQRTPTWQRRLRSEDLLREALPYGGQFPFLKAAIDEC
LEEHLDGPHLRGILQGIEQGRIQIEVKDSDYPSPLATQFMFDYANTQVYEADTLNSDLQL
QLMNVSADLAISVFGQAALQNTIEPEVIEAELERQTIKPANANELFNLLKRQGDLNYREL
QVACGLEVDAWTEQLKEQGLVANVEIGQEERWICRDELEIYAQLGSNEVSAVFVLGRYIE
GRLSFSESGLRQRYRFTREYMQHMIKQWGEERRIQPSPFGTGKEQQADELWSSSRVCERI
LRQSLQHFRNAGEAADSSRLAMLLFHRHHLLPGQRLKGAEGLRQTLALLQGIYLPFSQWE
TLIFPTRIEGYRRSDLDGLCAAGEIIWLGRKASGEKEGKIAFFLAEAGNLISPLLPREVE
TETAHPELLNLLRVKGASYLTKLSAELGLAPSELLNQLFDLVWEGQVSNDQFSPLRNYSM
AKEKLHPKLGSGLGRWYVTQSLEVEVTLEETAVAWVRQLLHCHGIITKDIVAAYSPLLWE
PLLQVLRRLEELGNLTRGLFVKEIETLQFMEHDVVTQMRRSDSNLENSQNDIVAVNACEP
ASIYGNLVPWPDVRGAAFARKPGNYLLFQHGNWAGWLENNAKKVVFLKQDQPIQPELLLP
VFTQLLKNGSMKKIVIDTWNGQKAMETEAGKVLLKHGAERDRDSLVLWLSAMG
NT seq 4302 nt   +upstreamnt  +downstreamnt
atgaggatgcttcatagtgcattgcagccgtttcaccctacagtggcagcatggttcgtg
cagtctttcaaccaaccgacagatgttcagatccaagcgtggagctcgcttaggcagaat
caacatacgttgattgcagctccaaccggttcgggtaagacgttagcagcgctattgcct
ggattgaatcaaatcatgcaagataagcttgctggaatgaatcagactccgggcattcgc
ctgttatacatcaccccgttaaaggcgctgaacaatgatgttcatcttcacgttgtgcag
tttgcagagcaattgcatgagctggctgcggcaacgacacaagactggccgggtttgaga
gctgctgtccgtacaggtgataccccgcagaatgtgcgaaatgccattcttcgcaagcca
ccagatattctggttattacaccagaatcgctatatttaatgctgacctccgagaaagcg
cgcgaggttttacgaacggttacttatgtcatagtagatgaaattcatcatattgctgga
gataaaagaggagcacatctgtcacttacactggaacgtctggtggaatggtgcgggtgc
tcttttctgcgcgtgggtgtttcagcaactcagaagccattggaccaagtagcaaggttc
ttaggaggctgggaggaagctgaggctagagctgtacatattatcgaaagccatgaggat
aaaatattcaacctaaccgtatccgttcctgatcctattgcagtcttgcatgataaagag
gcggtatgggcggtcctgatggagcgtattcttaaagaaatgacagattgtcgttctacg
attatttttgtgaataatcgtagactctgtgagcgacttactcaaagattaaatgattat
tgcggcggtggttttgctagatcccaccatggcagcttatcccgcgaaaagcgcttggag
gtcgaacagctgctgaagcaaggggatctaaaatgcctcattgccacctcctcgttagag
ctggggatagatgtgggtcatattgatctggtgattcagatcgactcacccctgcaagcc
gcttctgggattcagcggatgggtcgagcaggtcatggagttggcgaggtaagccgcggt
gtgattatagttcgtcagcgcagctcgctgcctgaagcagccgtgctgtgtcggatgata
cgtaggcgtgagattgaactaattcggatccggcgcaatgctctggatgtgctagctcag
caaatagtagcgatgacggccatggatgattggcacgtagaaggaatttggcggttaatt
caacgcagtgatagctatcataattttccgcgcgaaagaatggagtcgttgttgcaggtt
ttatcgggcttttttccgtttgtgcgtccacttctgctctggaatcgggaaacgaatgta
ctcagtcgacatagcagctctagaatggcggcaattatgggcacgggcactattccacaa
agcgcgaattttccagtctttcagggtgagagcaacattcagatcggtgatttggatgag
gagtttgttcatgaaagccgaaccggtgaagtattccaaatgggcgctcaatcctgggtg
attcgtgagattaaacgagatcgtgttgtggtgagtgaggctaaaaatcgggttagtgag
attccattttggcgtaatgagggtttggggcgatcttatgagctaggggagaagatgggc
gttttagttgcggaggtttgcgatcggctagctgttaaggattcagatatcgagactgta
gagtggcttagagctgaatatggtctcgattcgctagcggcaaatggccttatggatttg
atgagtaagcagcaggcaactagcgcaatgccgactaatcggaagatcgtaatagaacgg
tatgtagatttgaccaaccaaacccatgttattctccataattattggggcagaagctta
aaccggtcatggcaaattattctcgaacggctctttgagcagaatcttccttataaacct
tatagcgtcgcgaaagataatgggattgagctaatttttaaacaatgggatcatgcagga
caatatttgatttggaaaatagctgcggattctgtggaaaaactcctgttggaggcgatt
ggtaagcttccgatgtttgcgataacctttcggagaattgccgatgttgcgcttttgctg
tcacgtcagtttcaacgtaccccaacctggcagcggaggctgcgcagtgaggatttgctg
cgtgaagcattgccatacggaggtcaatttccgtttcttaaagcggcgattgatgaatgc
ttggaagagcatctggatggcccgcatttaaggggtattttgcaggggattgaacagggg
agaattcaaattgaggtaaaggacagtgactatccttcgccattggccacacagtttatg
ttcgattatgcgaatacgcaagtttatgaagcagacacgttgaactccgaccttcagctt
cagctgatgaatgtgagtgcggatttggctataagtgtattcgggcaggctgcattgcag
aatacgattgaaccggaagtaatcgaggcggagctggagagacagaccattaagccggct
aatgccaatgaattatttaacttgctcaaaaggcaaggggacttaaattatcgcgagctt
caggtggcttgtggactcgaggtggatgcttggacggagcaactgaaagagcaaggtcta
gttgcgaatgtggagataggacaagaagagaggtggatctgccgggatgaactggagatc
tatgctcagcttgggagtaatgaggtctcagcagttttcgtgcttgggcgttatatcgaa
gggcggctttcattctcagagtcgggtcttagacaaagatataggttcacccgtgagtac
atgcagcatatgataaagcagtggggtgaagagcgacgtatccagccttcgccttttggg
acgggaaaagagcaacaggcggatgagttatggtcgagcagccgagtatgcgagcggatc
ctgcgtcaatcgttgcagcactttcgtaatgcaggtgaagctgcagattcttcacgactt
gcgatgctgctcttccataggcatcatttgcttccggggcaacgcttaaaaggagcggag
ggtttaaggcagacccttgcgctgctgcagggtatttatctacctttttctcagtgggag
acgcttatttttccgactcgtattgaaggctaccgcagatcagatttggatggcctgtgt
gccgctggtgaaatcatttggctaggacgaaaggccagtggggaaaaggaaggcaagatt
gccttttttctagctgaagcagggaatctgatttcaccgttattgccgagagaggttgaa
accgaaacagctcatccagaactgctgaaccttctacgtgttaagggagcaagctatcta
actaagctttcggcagaacttggcttagctccgtcggagctgcttaatcaattgttcgac
ctggtttgggaagggcaggtttccaacgatcaattctcgccactgcgcaattatagtatg
gccaaagagaagctccatccaaagctaggctcaggtttagggagatggtatgtgactcaa
tcactggaagtggaagttacattagaggagactgctgtggcttgggttcgtcaactgctg
cattgccatggcatcataactaaagatattgttgctgcctattcccctctattgtgggag
ccgctgctgcaggtgcttcgccgacttgaagagctaggcaaccttactcgcgggttattt
gttaaagaaattgagactttgcagttcatggagcacgatgtggttacccaaatgcgtaga
tccgattcaaacttggaaaatagtcaaaacgatattgtagctgtgaatgcttgtgaaccc
gccagtatatatggtaatttggtgccttggccagatgtgaggggagcagcttttgctcgt
aaaccaggtaattatttactttttcagcatgggaattgggcaggatggcttgaaaataat
gcgaaaaaggttgtttttcttaaacaagaccagccgatacagccggagctgctgctcccc
gtattcacacagctgcttaaaaacgggagtatgaaaaaaatagtaatcgatacctggaat
ggccaaaaagctatggaaaccgaagcgggaaaggttctgttgaagcatggggcggagcgt
gatcgcgattcgttagttttatggttgagtgccatgggttga

DBGET integrated database retrieval system