KEGG   Paenibacillus psychroresistens: EHS13_03425
Entry
EHS13_03425       CDS       T06328                                 

Definition
(GenBank) ribonuclease H
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_03425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_03425
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     EHS13_03425
DNA replication proteins [BR:ppsc03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    EHS13_03425
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     EHS13_03425
   Elongation factors (archaeal)
     EHS13_03425
SSDB
Motif
Pfam: Cauli_VI RNase_H RVT_3
Other DBs
NCBI-ProteinID: QGQ94027
UniProt: A0A6B8RDN1
LinkDB
Position
701082..701720
AA seq 212 aa
MAKQKYYVVWAGKKPGIYTSWAETQLQVNQFTGAKFKSYESQKEAEAAYRAGPSKNWGQG
QKPKTAAKPTETNSEHASIIMDSLSVDVGCSGNPGIVEYKGVDTQSGEVIFAVGPISKGT
NNMGEFLAIVHALAHLKKLGSSRTIYSDSRTALKWVQQKQAASTLVRDDSTKEIWELMDR
AVKWLQSNTYTNKVLKWETKEWGEIKADYGRK
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgaagcaaaaatattatgtagtatgggctggcaaaaagcccggaatttatacaagc
tgggctgaaactcaattgcaggtaaatcaatttacgggagccaagttcaagtcctatgaa
tctcaaaaagaagccgaggcagcctatcgagcaggaccaagcaagaattggggacaaggg
cagaagccaaagacagcagcaaaaccaacggaaaccaattcagagcatgcctctattatt
atggacagcttatcggttgatgtcggctgcagtggcaatccggggattgttgaatataaa
ggtgtggatacacagtcgggcgaagtgatttttgctgtcgggccgatcagtaaagggacg
aacaatatgggcgaatttctcgccattgttcacgcgctcgctcatttaaaaaaattaggc
agctcgcgcaccatatatagtgattcgcgaaccgccttgaaatgggtgcagcagaaacaa
gcggcctctactttggtgagagatgattccaccaaagaaatatgggagctaatggatcgg
gctgttaaatggctgcaatcaaatacatatacaaacaaagtcctgaagtgggaaaccaaa
gagtggggcgagattaaagcggattatgggcggaagtag

DBGET integrated database retrieval system